Gene/Proteome Database (LMPD)

LMPD ID
LMP013339
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
prostate transmembrane protein, androgen induced 1
Gene Symbol
Synonyms
Tmepai;
Alternate Names
transmembrane prostate androgen-induced protein; transmembrane, prostate androgen induced RNA;
Chromosome
3
Map Location
3q42

Proteins

transmembrane prostate androgen-induced protein precursor
Refseq ID NP_001101277
Protein GI 157823351
UniProt ID M0RCH9
mRNA ID NM_001107807
Length 230
MMVMVVMITCLLSHYKLSARSFISRHSQARRRDDGGLSSEGCLWPSESTVSGGMPEPQVYAPPRPTDRLAVPPFVQRSRFQPTYPYLQHEIALPPTISLSDGEEPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLIDSSMLGGPCPPSSNSGISATCYSSGGRMEGPPPTYSEVIGHYPGSSFQQHQQSNGQSSLLEGTRLHHPHIAPLENKEKEKQKGHPL
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2171 peptide sequence: MMVMVVMITCLLSHYKLSA

Gene Information

Entrez Gene ID
Gene Name
prostate transmembrane protein, androgen induced 1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane

REACTOME Pathway Links

REACTOME Pathway ID Description
5953253 Disease
5953838 Downregulation of TGF-beta receptor signaling
5953818 Loss of Function of SMAD2/3 in Cancer
5953821 Loss of Function of SMAD4 in Cancer
5953827 Loss of Function of TGFBR1 in Cancer
5953824 Loss of Function of TGFBR2 in Cancer
5953822 SMAD2/3 MH2 Domain Mutants in Cancer
5953817 SMAD2/3 Phosphorylation Motif Mutants in Cancer
5953820 SMAD4 MH2 Domain Mutants in Cancer
5953381 Signal Transduction
5953816 Signaling by TGF-beta Receptor Complex
5953819 Signaling by TGF-beta Receptor Complex in Cancer
5953815 TGF-beta receptor signaling activates SMADs
5953826 TGFBR1 KD Mutants in Cancer
5953828 TGFBR1 LBD Mutants in Cancer
5953825 TGFBR2 Kinase Domain Mutants in Cancer
5953823 TGFBR2 MSI Frameshift Mutants in Cancer

Domain Information

InterPro Annotations

Accession Description

UniProt Annotations

Entry Information

Gene Name
prostate transmembrane protein, androgen induced 1
Protein Entry
M0RCH9_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013339 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157823351 RefSeq NP_001101277 230 transmembrane prostate androgen-induced protein precursor

Identical Sequences to LMP013339 proteins

Reference Database Accession Length Protein Name
GI:157823351 GenBank EDL85115.1 230 transmembrane, prostate androgen induced RNA (predicted) [Rattus norvegicus]

Related Sequences to LMP013339 proteins

Reference Database Accession Length Protein Name
GI:157823351 EMBL CAD29011.1 274 unnamed protein product [Mus musculus]
GI:157823351 GenBank EDL85115.1 230 transmembrane, prostate androgen induced RNA (predicted) [Rattus norvegicus]
GI:157823351 GenBank AAI60278.1 274 Prostate transmembrane protein, androgen induced 1 [synthetic construct]
GI:157823351 RefSeq XP_006235751.1 277 PREDICTED: transmembrane prostate androgen-induced protein isoform X1 [Rattus norvegicus]