Gene/Proteome Database (LMPD)

LMPD ID
LMP013265
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
peroxisomal biogenesis factor 13
Gene Symbol
Alternate Names
peroxisome biogenesis factor 13; peroxisomal membrane protein PEX13;
Chromosome
14
Map Location
14q22

Proteins

peroxisome biogenesis factor 13
Refseq ID NP_001100712
Protein GI 157822049
UniProt ID D4A2Y9
mRNA ID NM_001107242
Length 403
MASQPPPPPKPWETRRIPGAGPGPGPGPTFQSADLGPTLLTRPGQPTLTRVPPPILPRPSQQTGGNNVNTFRPAYSSFSSGYGAYGNAFYGSYSPYSYGYNGLGFNRLRVDDLPPSRFVQQAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKVFSAFALVRTIRYLYRRLQWMMGLRRGSENEDLWAESEGTVACLGAEDQANNSAKSWPIFLFFAVILGGPYLIWKLLSTHSDEVTDSTNWANGEDDHVVARAEYDFAAVSDEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRRGRKTVESSTMPKQQQSFTNPTSVKGVTTTNSLEEQEAAFESVFVETNKVAGTPDSTGKNGDKQDL

Gene Information

Entrez Gene ID
Gene Name
peroxisomal biogenesis factor 13
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005779 IEA:Ensembl C integral component of peroxisomal membrane
GO:0005778 IDA:BHF-UCL C peroxisomal membrane
GO:0005777 IDA:RGD C peroxisome
GO:0021795 IEA:Ensembl P cerebral cortex cell migration
GO:0001561 IEA:Ensembl P fatty acid alpha-oxidation
GO:0007626 IEA:Ensembl P locomotory behavior
GO:0060152 IEA:Ensembl P microtubule-based peroxisome localization
GO:0001764 IEA:Ensembl P neuron migration
GO:0016560 IEA:Ensembl P protein import into peroxisome matrix, docking
GO:0001967 IEA:Ensembl P suckling behavior

KEGG Pathway Links

KEGG Pathway ID Description
ko04146 Peroxisome
rno04146 Peroxisome

Domain Information

InterPro Annotations

Accession Description
IPR007223 Peroxin 13, N-terminal
IPR001452 SH3_domain

UniProt Annotations

Entry Information

Gene Name
peroxisomal biogenesis factor 13
Protein Entry
D4A2Y9_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013265 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157822049 RefSeq NP_001100712 403 peroxisome biogenesis factor 13

Identical Sequences to LMP013265 proteins

Reference Database Accession Length Protein Name
GI:157822049 GenBank EDL97993.1 403 peroxisomal biogenesis factor 13 (predicted) [Rattus norvegicus]

Related Sequences to LMP013265 proteins

Reference Database Accession Length Protein Name
GI:157822049 DBBJ BAC26296.1 405 unnamed protein product [Mus musculus]
GI:157822049 DBBJ BAC26402.1 405 unnamed protein product [Mus musculus]
GI:157822049 DBBJ BAC27526.1 405 unnamed protein product [Mus musculus]
GI:157822049 GenBank EDL97993.1 403 peroxisomal biogenesis factor 13 (predicted) [Rattus norvegicus]