Gene/Proteome Database (LMPD)
Proteins
| peroxisome biogenesis factor 13 | |
|---|---|
| Refseq ID | NP_001100712 |
| Protein GI | 157822049 |
| UniProt ID | D4A2Y9 |
| mRNA ID | NM_001107242 |
| Length | 403 |
| MASQPPPPPKPWETRRIPGAGPGPGPGPTFQSADLGPTLLTRPGQPTLTRVPPPILPRPSQQTGGNNVNTFRPAYSSFSSGYGAYGNAFYGSYSPYSYGYNGLGFNRLRVDDLPPSRFVQQAEESSRGAFQSIESIVHAFASVSMMMDATFSAVYNSFRAVLDVANHFSRLKIHFTKVFSAFALVRTIRYLYRRLQWMMGLRRGSENEDLWAESEGTVACLGAEDQANNSAKSWPIFLFFAVILGGPYLIWKLLSTHSDEVTDSTNWANGEDDHVVARAEYDFAAVSDEEISFRAGDMLNLALKEQQPKVRGWLLASLDGQTTGLIPANYVKILGKRRGRKTVESSTMPKQQQSFTNPTSVKGVTTTNSLEEQEAAFESVFVETNKVAGTPDSTGKNGDKQDL | |
Gene Information
Entrez Gene ID
Gene Name
peroxisomal biogenesis factor 13
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005779 | IEA:Ensembl | C | integral component of peroxisomal membrane |
| GO:0005778 | IDA:BHF-UCL | C | peroxisomal membrane |
| GO:0005777 | IDA:RGD | C | peroxisome |
| GO:0021795 | IEA:Ensembl | P | cerebral cortex cell migration |
| GO:0001561 | IEA:Ensembl | P | fatty acid alpha-oxidation |
| GO:0007626 | IEA:Ensembl | P | locomotory behavior |
| GO:0060152 | IEA:Ensembl | P | microtubule-based peroxisome localization |
| GO:0001764 | IEA:Ensembl | P | neuron migration |
| GO:0016560 | IEA:Ensembl | P | protein import into peroxisome matrix, docking |
| GO:0001967 | IEA:Ensembl | P | suckling behavior |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013265 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157822049 | RefSeq | NP_001100712 | 403 | peroxisome biogenesis factor 13 |
Identical Sequences to LMP013265 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157822049 | GenBank | EDL97993.1 | 403 | peroxisomal biogenesis factor 13 (predicted) [Rattus norvegicus] |
Related Sequences to LMP013265 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157822049 | DBBJ | BAC26296.1 | 405 | unnamed protein product [Mus musculus] |
| GI:157822049 | DBBJ | BAC26402.1 | 405 | unnamed protein product [Mus musculus] |
| GI:157822049 | DBBJ | BAC27526.1 | 405 | unnamed protein product [Mus musculus] |
| GI:157822049 | GenBank | EDL97993.1 | 403 | peroxisomal biogenesis factor 13 (predicted) [Rattus norvegicus] |