Gene/Proteome Database (LMPD)
LMPD ID
LMP013242
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
zinc finger, DHHC-type containing 4
Gene Symbol
Alternate Names
probable palmitoyltransferase ZDHHC4; DHHC-4; zinc finger, DHHC domain containing 4; zinc finger DHHC domain-containing protein 4; membrane-associated DHHC4 zinc finger protein;
Chromosome
12
Map Location
12p11
EC Number
2.3.1.225
Proteins
| probable palmitoyltransferase ZDHHC4 | |
|---|---|
| Refseq ID | NP_001013141 |
| Protein GI | 61557015 |
| UniProt ID | Q5FVR1 |
| mRNA ID | NM_001013123 |
| Length | 343 |
| MDFLVLFSFYLAFLLICVIMICIFTKSQRLKAVVLGGAQVCARVTPQCFQRAVQTLLHQLFHTRHPAFLALHLLLQGLVYAEYTYEVFSYCRELEFSLPCLLLPYVLLSVNLVFFTLTCSTNPGTITKTNVLLLLQVYEFDEVMFPKNSRCSTCDLRKPARSKHCRVCDRCVHRFDHHCVWVNNCIGAWNTGYFLIYLLTLTASAATIAILSAAFLLRLVAVSNLYQETYLDDLGRFQAVDTGFLIQHLFLAFPRIIFLLGFVIVLSLLLAGYLCFALYLAATNQTTNEWYRGDWAWCQHWPLVAWSPSAEPQIHQNIYSHGLWSNLQEVFIPATPSYKKKKR | |
Gene Information
Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 4
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity |
| Similarity | Belongs to the DHHC palmitoyltransferase family |
| Similarity | Contains 1 DHHC-type zinc finger |
| Subcellular Location | Membrane ; Multi-pass membrane protein . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013242 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 61557015 | RefSeq | NP_001013141 | 343 | probable palmitoyltransferase ZDHHC4 |
Identical Sequences to LMP013242 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61557015 | GenBank | AAH89831.1 | 343 | Zinc finger, DHHC-type containing 4 [Rattus norvegicus] |
| GI:61557015 | GenBank | AAX73385.1 | 343 | membrane-associated DHHC4 zinc finger protein [Rattus norvegicus] |
| GI:61557015 | SwissProt | Q5FVR1.1 | 343 | RecName: Full=Probable palmitoyltransferase ZDHHC4; AltName: Full=Zinc finger DHHC domain-containing protein 4; Short=DHHC-4 [Rattus norvegicus] |
Related Sequences to LMP013242 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:61557015 | GenBank | AAH89831.1 | 343 | Zinc finger, DHHC-type containing 4 [Rattus norvegicus] |
| GI:61557015 | GenBank | AAX73385.1 | 343 | membrane-associated DHHC4 zinc finger protein [Rattus norvegicus] |
| GI:61557015 | RefSeq | XP_008767184.1 | 343 | PREDICTED: probable palmitoyltransferase ZDHHC4 isoform X1 [Rattus norvegicus] |
| GI:61557015 | SwissProt | Q5FVR1.1 | 343 | RecName: Full=Probable palmitoyltransferase ZDHHC4; AltName: Full=Zinc finger DHHC domain-containing protein 4; Short=DHHC-4 [Rattus norvegicus] |