Gene/Proteome Database (LMPD)

LMPD ID
LMP013242
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
zinc finger, DHHC-type containing 4
Gene Symbol
Alternate Names
probable palmitoyltransferase ZDHHC4; DHHC-4; zinc finger, DHHC domain containing 4; zinc finger DHHC domain-containing protein 4; membrane-associated DHHC4 zinc finger protein;
Chromosome
12
Map Location
12p11
EC Number
2.3.1.225

Proteins

probable palmitoyltransferase ZDHHC4
Refseq ID NP_001013141
Protein GI 61557015
UniProt ID Q5FVR1
mRNA ID NM_001013123
Length 343
MDFLVLFSFYLAFLLICVIMICIFTKSQRLKAVVLGGAQVCARVTPQCFQRAVQTLLHQLFHTRHPAFLALHLLLQGLVYAEYTYEVFSYCRELEFSLPCLLLPYVLLSVNLVFFTLTCSTNPGTITKTNVLLLLQVYEFDEVMFPKNSRCSTCDLRKPARSKHCRVCDRCVHRFDHHCVWVNNCIGAWNTGYFLIYLLTLTASAATIAILSAAFLLRLVAVSNLYQETYLDDLGRFQAVDTGFLIQHLFLAFPRIIFLLGFVIVLSLLLAGYLCFALYLAATNQTTNEWYRGDWAWCQHWPLVAWSPSAEPQIHQNIYSHGLWSNLQEVFIPATPSYKKKKR

Gene Information

Entrez Gene ID
Gene Name
zinc finger, DHHC-type containing 4
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0019706 IEA:UniProtKB-EC F protein-cysteine S-palmitoyltransferase activity
GO:0008270 IEA:InterPro F zinc ion binding

Domain Information

InterPro Annotations

Accession Description
IPR001594 Zinc finger, DHHC-type, palmitoyltransferase

UniProt Annotations

Entry Information

Gene Name
zinc finger, DHHC-type containing 4
Protein Entry
ZDHC4_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
Domain The DHHC domain is required for palmitoyltransferase activity
Similarity Belongs to the DHHC palmitoyltransferase family
Similarity Contains 1 DHHC-type zinc finger
Subcellular Location Membrane ; Multi-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP013242 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
61557015 RefSeq NP_001013141 343 probable palmitoyltransferase ZDHHC4

Identical Sequences to LMP013242 proteins

Reference Database Accession Length Protein Name
GI:61557015 GenBank AAH89831.1 343 Zinc finger, DHHC-type containing 4 [Rattus norvegicus]
GI:61557015 GenBank AAX73385.1 343 membrane-associated DHHC4 zinc finger protein [Rattus norvegicus]
GI:61557015 SwissProt Q5FVR1.1 343 RecName: Full=Probable palmitoyltransferase ZDHHC4; AltName: Full=Zinc finger DHHC domain-containing protein 4; Short=DHHC-4 [Rattus norvegicus]

Related Sequences to LMP013242 proteins

Reference Database Accession Length Protein Name
GI:61557015 GenBank AAH89831.1 343 Zinc finger, DHHC-type containing 4 [Rattus norvegicus]
GI:61557015 GenBank AAX73385.1 343 membrane-associated DHHC4 zinc finger protein [Rattus norvegicus]
GI:61557015 RefSeq XP_008767184.1 343 PREDICTED: probable palmitoyltransferase ZDHHC4 isoform X1 [Rattus norvegicus]
GI:61557015 SwissProt Q5FVR1.1 343 RecName: Full=Probable palmitoyltransferase ZDHHC4; AltName: Full=Zinc finger DHHC domain-containing protein 4; Short=DHHC-4 [Rattus norvegicus]