Gene/Proteome Database (LMPD)
Proteins
| alkaline ceramidase 1 | |
|---|---|
| Refseq ID | NP_001100345 |
| Protein GI | 157822473 |
| UniProt ID | M0R603 |
| mRNA ID | NM_001106875 |
| Length | 273 |
| MYAPSTRAKMSSIFAYQSSEVDWCESNFQHSELVAEFYNTFSNVFFLIFGPLMMFLMHPYAQKRSWGIYGVSVLFMVIGLFSMYFHMTLSFVGQLLDEISILWLLASGYSVWLPRCYFPKFIKGSRFYFSCLVIMTTIISTFLTFVKPTVNAYALNSIAIHILYIVRKEYKKTSNRDLRHLIAVSVILWAAALTSWVSDRVLCSFWQRIQFFYLHSIWHVLISITFPYGIVTMALVDAKYEMPDKTLKVHYWPRDSWLIGLPYVEIQENDKNC | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:Ensembl | C | endoplasmic reticulum |
| GO:0016021 | IEA:InterPro | C | integral component of membrane |
| GO:0071633 | IEA:Ensembl | F | dihydroceramidase activity |
| GO:0071277 | IEA:Ensembl | P | cellular response to calcium ion |
| GO:0046514 | IEA:Ensembl | P | ceramide catabolic process |
| GO:0030216 | IEA:Ensembl | P | keratinocyte differentiation |
| GO:0019216 | IEA:Ensembl | P | regulation of lipid metabolic process |
| GO:0010446 | IEA:Ensembl | P | response to alkaline pH |
| GO:0046512 | IEA:Ensembl | P | sphingosine biosynthetic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| rno01100 | Metabolic pathways |
| ko00600 | Sphingolipid metabolism |
| rno00600 | Sphingolipid metabolism |
| M00099 | Sphingosine biosynthesis |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR008901 | Ceramidase |
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013201 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157822473 | RefSeq | NP_001100345 | 273 | alkaline ceramidase 1 |
Identical Sequences to LMP013201 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157822473 | GenBank | EDL83598.1 | 273 | similar to N-acylsphingosine amidohydrolase 3 [Rattus norvegicus] |
Related Sequences to LMP013201 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157822473 | GenBank | AAL83821.1 | 273 | alkaline ceramidase [Mus musculus] |
| GI:157822473 | GenBank | AAI30255.1 | 273 | Alkaline ceramidase 1 [Mus musculus] |
| GI:157822473 | GenBank | EDL83598.1 | 273 | similar to N-acylsphingosine amidohydrolase 3 [Rattus norvegicus] |
| GI:157822473 | GenBank | AGF22455.1 | 273 | Sequence 15 from patent US 8372595 |