Gene/Proteome Database (LMPD)
Proteins
| methylmalonyl-CoA epimerase, mitochondrial | |
|---|---|
| Refseq ID | NP_001099811 |
| Protein GI | 157821869 |
| UniProt ID | D4A197 |
| mRNA ID | NM_001106341 |
| Length | 178 |
| MRLVVKAAALAAGATGLFSRVQTPVAAGRSFSTSPSQHQASSPVWKLGRLNHVAIAVPDLEKASSFYRDVLGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGSDSPIAGFLQKNKAGGMHHVCIEVDNINAAVMDLKKQKIRSLSDEAKIGAHGKPVIFLHPKDCGGVLVELEQA | |
Gene Information
Entrez Gene ID
Gene Name
methylmalonyl CoA epimerase
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IEA:Ensembl | C | mitochondrion |
| GO:0004493 | IEA:Ensembl | F | methylmalonyl-CoA epimerase activity |
| GO:0046491 | IEA:Ensembl | P | L-methylmalonyl-CoA metabolic process |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko01200 | Carbon metabolism |
| rno01200 | Carbon metabolism |
| ko00630 | Glyoxylate and dicarboxylate metabolism |
| rno00630 | Glyoxylate and dicarboxylate metabolism |
| rno01100 | Metabolic pathways |
| ko00640 | Propanoate metabolism |
| rno00640 | Propanoate metabolism |
| ko00280 | Valine, leucine and isoleucine degradation |
| rno00280 | Valine, leucine and isoleucine degradation |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Identical and Related Proteins
Unique RefSeq proteins for LMP013112 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 157821869 | RefSeq | NP_001099811 | 178 | methylmalonyl-CoA epimerase, mitochondrial |
Identical Sequences to LMP013112 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157821869 | GenBank | EDM08394.1 | 178 | methylmalonyl CoA epimerase (predicted), isoform CRA_d [Rattus norvegicus] |
Related Sequences to LMP013112 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:157821869 | GenBank | AAH38157.1 | 178 | Methylmalonyl CoA epimerase [Mus musculus] |
| GI:157821869 | GenBank | EDL07253.1 | 178 | methylmalonyl CoA epimerase, isoform CRA_a [Mus musculus] |
| GI:157821869 | GenBank | EDM08394.1 | 178 | methylmalonyl CoA epimerase (predicted), isoform CRA_d [Rattus norvegicus] |
| GI:157821869 | RefSeq | NP_082902.1 | 178 | methylmalonyl-CoA epimerase, mitochondrial precursor [Mus musculus] |