Gene/Proteome Database (LMPD)

LMPD ID
LMP013100
Gene ID
293453
Species
Rattus norvegicus (Rat)
Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1
Gene Symbol
Ndufab1
Alternate Names
acyl carrier protein, mitochondrial;
Chromosome
1
Map Location
1q36

Proteins

acyl carrier protein, mitochondrial
Refseq ID NP_001099764
Protein GI 157820787
UniProt ID D3ZF13
mRNA ID NM_001106294
Length 156
MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTILCPEGIWRRTGTLQPTLALAQVPGTVTHLCRQYSDAPPLTLEGIRDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYD

Gene Information

Entrez Gene ID
293453
Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1
Gene Symbol
Ndufab1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0006633 IEA:UniProtKB-KW P fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko05010 Alzheimer's disease
rno05010 Alzheimer's disease
ko05016 Huntington's disease
rno05016 Huntington's disease
rno01100 Metabolic pathways
M00146 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
ko04932 Non-alcoholic fatty liver disease (NAFLD)
rno04932 Non-alcoholic fatty liver disease (NAFLD)
ko00190 Oxidative phosphorylation
rno00190 Oxidative phosphorylation
rno05012 Parkinson's disease

REACTOME Pathway Links

REACTOME Pathway ID Description
5953250 Metabolism
5953747 Respiratory electron transport
5953748 Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
5953270 The citric acid (TCA) cycle and respiratory electron transport

Domain Information

InterPro Annotations

Accession Description
IPR003231 Acyl carrier protein (ACP)
IPR009081 Acyl carrier protein-like
IPR006162 Phosphopantetheine attachment site

UniProt Annotations

Entry Information

Gene Name
NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1
Protein Entry
D3ZF13_RAT
UniProt ID
D3ZF13
Species
Rat

Comments

Comment Type Description
Function Carrier of the growing fatty acid chain in fatty acid biosynthesis
Similarity Contains 1 acyl carrier domain

Identical and Related Proteins

Unique RefSeq proteins for LMP013100 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157820787 RefSeq NP_001099764 156 acyl carrier protein, mitochondrial

Identical Sequences to LMP013100 proteins

Reference Database Accession Length Protein Name
GI:157820787 GenBank EDM17569.1 156 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (predicted), isoform CRA_a [Rattus norvegicus]
GI:157820787 GenBank EDM17570.1 156 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (predicted), isoform CRA_a [Rattus norvegicus]
GI:157820787 GenBank EDM17571.1 156 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (predicted), isoform CRA_a [Rattus norvegicus]
GI:157820787 RefSeq XP_006230250.1 156 PREDICTED: acyl carrier protein, mitochondrial isoform X1 [Rattus norvegicus]

Related Sequences to LMP013100 proteins

Reference Database Accession Length Protein Name
GI:157820787 GenBank EDM17569.1 156 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (predicted), isoform CRA_a [Rattus norvegicus]
GI:157820787 GenBank EDM17570.1 156 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (predicted), isoform CRA_a [Rattus norvegicus]
GI:157820787 GenBank EDM17571.1 156 NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1 (predicted), isoform CRA_a [Rattus norvegicus]
GI:157820787 RefSeq XP_006230250.1 156 PREDICTED: acyl carrier protein, mitochondrial isoform X1 [Rattus norvegicus]