Gene/Proteome Database (LMPD)
LMPD ID
LMP013075
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
StAR-related lipid transfer (START) domain containing 6
Gene Symbol
Alternate Names
stAR-related lipid transfer protein 6; START domain containing protein 6; STAR-related lipid transfer (START) domain containing protein 6;
Chromosome
18
Map Location
18q12.1
Proteins
| stAR-related lipid transfer protein 6 | |
|---|---|
| Refseq ID | NP_001007628 |
| Protein GI | 56090253 |
| UniProt ID | Q6AYN5 |
| mRNA ID | NM_001007627 |
| Length | 227 |
| MDYKAIAQQSAEQVLAYNQDLSGWKVVKTSKKVTVSSKASKLFQGNLYRIEGVIPELPAHLSDFLYKSEHRVSWDKSLKAFNMIHKIDSDTLICHTITQSFAMGSISPRDFIDLVHIKHQDGNMDIISTRSVEFPGYPPTSHYIRGYNHPSGYVCSPLKENPAYSKLVVFVQTEMKGKLLASVIEKSMPSNLVSFFLNVKDGLKIHKAPIPALRSHHSMHSAVHKKK | |
Gene Information
Entrez Gene ID
Gene Name
StAR-related lipid transfer (START) domain containing 6
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0008289 | IEA:InterPro | F | lipid binding |
Domain Information
UniProt Annotations
Entry Information
Gene Name
StAR-related lipid transfer (START) domain containing 6
Protein Entry
Q6AYN5_RAT
UniProt ID
Species
Rat
Identical and Related Proteins
Unique RefSeq proteins for LMP013075 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 56090253 | RefSeq | NP_001007628 | 227 | stAR-related lipid transfer protein 6 |
Identical Sequences to LMP013075 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:56090253 | GenBank | EDM14786.1 | 227 | STAR-related lipid transfer (START) domain containing protein 6, isoform CRA_a [Rattus norvegicus] |
| GI:56090253 | RefSeq | XP_006254983.1 | 227 | PREDICTED: stAR-related lipid transfer protein 6 isoform X1 [Rattus norvegicus] |
| GI:56090253 | RefSeq | XP_008770333.1 | 227 | PREDICTED: stAR-related lipid transfer protein 6 isoform X1 [Rattus norvegicus] |
| GI:56090253 | RefSeq | XP_008770334.1 | 227 | PREDICTED: stAR-related lipid transfer protein 6 isoform X1 [Rattus norvegicus] |
Related Sequences to LMP013075 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:56090253 | GenBank | EDM14781.1 | 227 | STAR-related lipid transfer (START) domain containing protein 6, isoform CRA_a [Rattus norvegicus] |
| GI:56090253 | GenBank | EDM14783.1 | 227 | STAR-related lipid transfer (START) domain containing protein 6, isoform CRA_a [Rattus norvegicus] |
| GI:56090253 | RefSeq | XP_008770333.1 | 227 | PREDICTED: stAR-related lipid transfer protein 6 isoform X1 [Rattus norvegicus] |
| GI:56090253 | RefSeq | XP_008770334.1 | 227 | PREDICTED: stAR-related lipid transfer protein 6 isoform X1 [Rattus norvegicus] |