Gene/Proteome Database (LMPD)

LMPD ID
LMP013056
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
cytochrome P450, family 4, subfamily f, polypeptide 18
Gene Symbol
Synonyms
Cyp4f3;
Alternate Names
leukotriene-B(4) omega-hydroxylase 2; cyp4f3; CYPIVF3; cytochrome P450 4F3; cytochrome P450-LTB-omega; leukotriene-B(4) 20-monooxygenase 2;
Chromosome
16
Map Location
16p14
EC Number
1.14.13.30

Proteins

leukotriene-B(4) omega-hydroxylase 2
Refseq ID NP_001028858
Protein GI 76096310
UniProt ID Q3MID2
mRNA ID NM_001033686
Length 524
MPLLSLSWLGLGHTAASPWLLLLLVGASCLLAYILPQVYAVFENSRRLRRFPQPPPRNWLFGHLGLIQSSEEGLLYIQSLSRTFRDVCCWWVGPWHPVIRIFHPAFIKPVILAPASVAPKDRVFYRFLRPWLGDGLLLSTGDKWSRHRRMLTPAFHFNILKPYVKIFNDSTNIMHAKWQRLASQGSARLDMFEHISLMTLDSLQKCVFSFDSNCQEKPSEYITAILELSALVARRHQSLLLHVDLFYHLTRDGMRFRKACRLVHDFTDAVIRERRCTLPDQGGDDALKAKAKAKTLDFIDVLLLSKDEHGEALSDEDIRAEADTFMFGGHDTTASGLSWILYNLAKHPEYQERCRQEVRELLRDREPEEIEWDDLAQLPFLTMCIKESLRLHPPATAISRCCTQDIMLPDGRVIPKGVICRISIFGTHHNPAVWPDPEVYNPFRFDADNGKGRSPLAFIPFSAGPRNCIGQTFAMSEMKVALALTLLRFRVLPDDKEPRRKPELILRAEGGLWLRVEPLSAGAH

Gene Information

Entrez Gene ID
Gene Name
cytochrome P450, family 4, subfamily f, polypeptide 18
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005783 IEA:UniProtKB-KW C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0052871 IEA:UniProtKB-EC F alpha-tocopherol omega-hydroxylase activity
GO:0020037 IEA:InterPro F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0050051 IEA:UniProtKB-EC F leukotriene-B4 20-monooxygenase activity

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
rno00590 Arachidonic acid metabolism
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR002401 Cytochrome P450, E-class, group I
IPR017972 Cytochrome P450, conserved site

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 4, subfamily f, polypeptide 18
Protein Entry
CP4F3_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity (6Z,8E,10E,14Z)-(5S,12R)-5,12-dihydroxyicosa- 6,8,10,14-tetraenoate + NADPH + O(2) = (6Z,8E,10E,14Z)-(5S,12R)- 5,12,20-trihydroxyicosa-6,8,10,14-tetraenoate + NADP(+) + H(2)O
Cofactor Name=heme; Xref=ChEBI:CHEBI:30413; Evidence= ;
Enzyme Regulation Inhibited by carbon monoxide (CO)
Function Cytochromes P450 are a group of heme-thiolate monooxygenases. This enzyme requires molecular oxygen and NADPH for the omega-hydroxylation of LTB4, a potent chemoattractant for polymorphonuclear leukocytes (By similarity)
Pathway Lipid metabolism; leukotriene B4 degradation.
Similarity Belongs to the cytochrome P450 family
Subcellular Location Endoplasmic reticulum membrane {ECO:0000250}; Single-pass membrane protein . Microsome membrane ; Single-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP013056 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
76096310 RefSeq NP_001028858 524 leukotriene-B(4) omega-hydroxylase 2

Identical Sequences to LMP013056 proteins

Reference Database Accession Length Protein Name
GI:76096310 GenBank AAI01919.1 524 Cytochrome P450, family 4, subfamily f, polypeptide 18 [Rattus norvegicus]
GI:76096310 SwissProt Q3MID2.1 524 RecName: Full=Leukotriene-B(4) omega-hydroxylase 2; AltName: Full=CYPIVF3; AltName: Full=Cytochrome P450 4F3; AltName: Full=Cytochrome P450-LTB-omega; AltName: Full=Leukotriene-B(4) 20-monooxygenase 2 [Rattus norvegicus]

Related Sequences to LMP013056 proteins

Reference Database Accession Length Protein Name
GI:76096310 GenBank AAK15013.1 524 cytochrome P450 CYP4F18 [Mus musculus]
GI:76096310 GenBank AAH13494.1 524 Cytochrome P450, family 4, subfamily f, polypeptide 18 [Mus musculus]
GI:76096310 GenBank AAI01919.1 524 Cytochrome P450, family 4, subfamily f, polypeptide 18 [Rattus norvegicus]
GI:76096310 SwissProt Q3MID2.1 524 RecName: Full=Leukotriene-B(4) omega-hydroxylase 2; AltName: Full=CYPIVF3; AltName: Full=Cytochrome P450 4F3; AltName: Full=Cytochrome P450-LTB-omega; AltName: Full=Leukotriene-B(4) 20-monooxygenase 2 [Rattus norvegicus]