Gene/Proteome Database (LMPD)

LMPD ID
LMP013052
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
annexin A11
Gene Symbol
Alternate Names
annexin A11;
Chromosome
16
Map Location
16p16

Proteins

annexin A11
Refseq ID NP_001011918
Protein GI 58865414
UniProt ID Q5XI77
mRNA ID NM_001011918
Length 503
MSYPGYPPPAGGYPPGAPGGAPWGGASYPPPSMPPIGLDNVANYAGQFNQDYLSGMAANMSGTFGGANVPNMYPGAPGGGYPPVPPGGFGQPPPAQQPVPPYGMYPPPGGNPPPGMPSYPAYPGAPVPGQPMPPPGQQPPGAYPGQPPMTYPGQSPMPPPGQQPVPSYPGYSGSSTITPAVPPAQFGNRGTITDASGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDVYEIKEAIKGAGTDEACLIEILASRSNEHIRELNRAYKTEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLVQRDVQELYAAGENRLGTDESKFNAILCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEQGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSELDLLDIRAEYKRMYGKSLYHDITGDTSGDYRKILLKICGGND

Gene Information

Entrez Gene ID
Gene Name
annexin A11
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0042582 IEA:Ensembl C azurophil granule
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016020 IEA:Ensembl C membrane
GO:0030496 IEA:Ensembl C midbody
GO:0005634 IEA:Ensembl C nucleus
GO:0045335 IEA:Ensembl C phagocytic vesicle
GO:0042581 IEA:Ensembl C specific granule
GO:0005819 IEA:Ensembl C spindle
GO:0005509 IEA:Ensembl F calcium ion binding
GO:0005544 IEA:UniProtKB-KW F calcium-dependent phospholipid binding
GO:0008429 IEA:Ensembl F phosphatidylethanolamine binding
GO:0044822 IEA:Ensembl F poly(A) RNA binding
GO:0007109 IEA:Ensembl P cytokinesis, completion of separation
GO:0006909 IEA:Ensembl P phagocytosis
GO:0051592 IEA:Ensembl P response to calcium ion

Domain Information

InterPro Annotations

Accession Description
IPR001464 Annexin
IPR018252 Annexin repeat, conserved site
IPR008157 Annexin, type XI
IPR018502 Annexin_repeat

UniProt Annotations

Entry Information

Gene Name
annexin A11
Protein Entry
Q5XI77_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Domain A pair of annexin repeats may form one binding site for calcium and phospholipid
Similarity Belongs to the annexin family
Similarity Contains 4 annexin repeats
Similarity Contains annexin repeats

Identical and Related Proteins

Unique RefSeq proteins for LMP013052 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
58865414 RefSeq NP_001011918 503 annexin A11

Identical Sequences to LMP013052 proteins

Reference Database Accession Length Protein Name
GI:58865414 GenBank AAH83812.1 503 Annexin A11 [Rattus norvegicus]
GI:58865414 GenBank EDL75087.1 503 rCG39189, isoform CRA_a [Rattus norvegicus]

Related Sequences to LMP013052 proteins

Reference Database Accession Length Protein Name
GI:58865414 GenBank AAH83812.1 503 Annexin A11 [Rattus norvegicus]
GI:58865414 GenBank EDL75087.1 503 rCG39189, isoform CRA_a [Rattus norvegicus]
GI:58865414 RefSeq XP_006991691.1 503 PREDICTED: annexin A11 [Peromyscus maniculatus bairdii]
GI:58865414 RefSeq XP_008769202.1 606 PREDICTED: annexin A11 isoform X1 [Rattus norvegicus]