Gene/Proteome Database (LMPD)
Proteins
| 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial | |
|---|---|
| Refseq ID | NP_001093978 |
| Protein GI | 213972556 |
| UniProt ID | G3V6R7 |
| mRNA ID | NM_001100508 |
| Length | 456 |
| MLSKCLQHFLKAHLYPASYCWLISKHKFSGSVPAAGSRRRVVITGIGLVTPLGVGTQLVWDRLLRGESGIVSVVGDEYKSIPCSVAAFVPRGSDKGQFNEQNFVSKSDAKSMSSPTIMAVGAAELALKDSGWYPKLEADQVATGVAIGMGMVPLEVVSETALMFQTKGYSKVSPFFVPKILINMAAGQVSIRYKLKGPNHSVSTACTTGAHAVGDSFRLIAHGDADVMVAGGTDSCISPLSLAGFSRARALSTNPDPKLACRPFHPERDGFVMGEGAAVLVLEEHEHAVQRGARIYAEVLGYGLSGDAGHITAPDPEGEGALRCMAAAVKDAGVSPDQISYVNAHATSTPLGDAAENRAIKRLFRDHARALAISSTKGATGHLLGAAGAVEAAFTALACYHHKLPPTLNLDCTEAEFDLNYVPLEAQEWKTEGRCIGLTNSFGFGGTNATLCIAGM | |
Gene Information
Entrez Gene ID
Gene Name
3-oxoacyl-ACP synthase, mitochondrial
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005739 | IEA:UniProtKB-SubCell | C | mitochondrion |
| GO:0004315 | IEA:UniProtKB-EC | F | 3-oxoacyl-[acyl-carrier-protein] synthase activity |
| GO:0006637 | IEA:Ensembl | P | acyl-CoA metabolic process |
| GO:0051792 | IEA:Ensembl | P | medium-chain fatty acid biosynthetic process |
| GO:0051790 | IEA:Ensembl | P | short-chain fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
3-oxoacyl-ACP synthase, mitochondrial
Protein Entry
G3V6R7_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Acyl-[acyl-carrier-protein] + malonyl-[acyl- carrier-protein] = 3-oxoacyl-[acyl-carrier-protein] + CO(2) + [acyl-carrier-protein] |
| Function | May play a role in the biosynthesis of lipoic acid as well as longer chain fatty acids required for optimal mitochondrial function |
| Pathway | Lipid metabolism; fatty acid biosynthesis |
| Similarity | Belongs to the beta-ketoacyl-ACP synthases family |
| Subcellular Location | Mitochondrion . |
Identical and Related Proteins
Unique RefSeq proteins for LMP013045 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 213972556 | RefSeq | NP_001093978 | 456 | 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial |
Identical Sequences to LMP013045 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:213972556 | GenBank | EDL94095.1 | 456 | rCG42150 [Rattus norvegicus] |
| GI:213972556 | RefSeq | XP_006251773.1 | 456 | PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial isoform X1 [Rattus norvegicus] |
Related Sequences to LMP013045 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:213972556 | GenBank | EDL94095.1 | 456 | rCG42150 [Rattus norvegicus] |
| GI:213972556 | RefSeq | XP_006251773.1 | 456 | PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial isoform X1 [Rattus norvegicus] |
| GI:213972556 | RefSeq | XP_006518164.1 | 459 | PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial isoform X2 [Mus musculus] |
| GI:213972556 | RefSeq | XP_006518165.1 | 459 | PREDICTED: 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial isoform X3 [Mus musculus] |