Gene/Proteome Database (LMPD)

LMPD ID
LMP013032
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
adiponectin receptor 1
Gene Symbol
Alternate Names
adiponectin receptor protein 1;
Chromosome
13
Map Location
13q13
Summary
mouse homolog acts as a receptor for adiponectin; facilitates activation of AMP kinase and PPAR-alpha and increased fatty acid oxidation [RGD, Feb 2006]
Orthologs

Proteins

adiponectin receptor protein 1
Refseq ID NP_997470
Protein GI 46485456
UniProt ID Q6P746
mRNA ID NM_207587
Length 375
MSSHKGSAVAQGNGAPSSNREADTVELAELGPLLEEKGKRAATSPAKAEEEQACPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDSLL

Gene Information

Entrez Gene ID
Gene Name
adiponectin receptor 1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016324 IDA:UniProtKB C apical plasma membrane
GO:0016323 IDA:UniProtKB C basolateral plasma membrane
GO:0005737 IDA:UniProtKB C cytoplasm
GO:0016021 IEA:InterPro C integral component of membrane
GO:0005886 IDA:RGD C plasma membrane
GO:0042562 IBA:RefGenome F hormone binding
GO:0004872 IBA:RefGenome F receptor activity
GO:0033211 IMP:RGD P adiponectin-activated signaling pathway
GO:0033210 IMP:RGD P leptin-mediated signaling pathway
GO:0030308 IMP:RGD P negative regulation of cell growth
GO:0046427 IMP:RGD P positive regulation of JAK-STAT cascade
GO:0046628 IMP:RGD P positive regulation of insulin receptor signaling pathway

KEGG Pathway Links

KEGG Pathway ID Description
ko04152 AMPK signaling pathway
rno04152 AMPK signaling pathway
ko04920 Adipocytokine signaling pathway
rno04920 Adipocytokine signaling pathway
ko04932 Non-alcoholic fatty liver disease (NAFLD)
rno04932 Non-alcoholic fatty liver disease (NAFLD)

Domain Information

InterPro Annotations

Accession Description
IPR004254 AdipoR/Haemolysin-III-related

UniProt Annotations

Entry Information

Gene Name
adiponectin receptor 1
Protein Entry
Q6P746_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013032 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
46485456 RefSeq NP_997470 375 adiponectin receptor protein 1

Identical Sequences to LMP013032 proteins

Reference Database Accession Length Protein Name
GI:46485456 GenBank AAH61838.1 375 Adiponectin receptor 1 [Rattus norvegicus]
GI:46485456 GenBank ACK09667.1 375 Sequence 165 from patent US 7435808
GI:46485456 GenBank ADA05745.1 375 Sequence 165 from patent US 7598348

Related Sequences to LMP013032 proteins

Reference Database Accession Length Protein Name
GI:46485456 GenBank AAH61838.1 375 Adiponectin receptor 1 [Rattus norvegicus]
GI:46485456 GenBank ACK09667.1 375 Sequence 165 from patent US 7435808
GI:46485456 GenBank ADA05745.1 375 Sequence 165 from patent US 7598348
GI:46485456 RefSeq XP_006249914.1 375 PREDICTED: adiponectin receptor protein 1 isoform X1 [Rattus norvegicus]