Gene/Proteome Database (LMPD)

LMPD ID
LMP013029
Gene ID
288752
Species
Rattus norvegicus (Rat)
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Gene Symbol
B3gnt4
Alternate Names
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4;
Chromosome
12
Map Location
12q16

Proteins

UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 precursor
Refseq ID NP_001099408
Protein GI 157786938
UniProt ID D4A3H6
mRNA ID NM_001105938
Length 349
MLRRLGCVLFCTLVVLLLGCLLFLKERTPAGSSEAHQHFLAPPRPHHSQCSPNLTVVNTSLSLPSRHRLFLTYRHCRNFSILLEPSECARDIFLLLVIKSQPAHIEQRAAIRSTWGRGGSWARGRQLKLVFLLGVAGPVPPAQLLAYESWQFDDILQWDFAEDFFNLTLKELHVQRWIAAACTQAHFILKGDDDVFIHVPNVLEFLEGWDPAQDLLVGDVIRLARPNRNTKVKYFIPFSMYRARHYPPYAGGGGYVMSQATVRHLHTAMEEAELFPIDDVFVGMCLRKLGVTPIHHAGFKTFGIQQPLNPRDPCLYRGLLLVHRLSPLEMWTMWALVTDERLECAARKP
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2120 peptide sequence: MLRRLGCVLFCTLVVLLLG

Gene Information

Entrez Gene ID
288752
Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Gene Symbol
B3gnt4
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008378 IEA:InterPro F galactosyltransferase activity
GO:0006486 IEA:InterPro P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno01100 Metabolic pathways

REACTOME Pathway Links

REACTOME Pathway ID Description
5953253 Disease
5953252 Glycogen storage diseases
5953861 Glycosaminoglycan metabolism
5954344 Keratan sulfate biosynthesis
5954345 Keratan sulfate/keratin metabolism
5953870 MPS I - Hurler syndrome
5953869 MPS II - Hunter syndrome
5953872 MPS IIIA - Sanfilippo syndrome A
5953864 MPS IIIB - Sanfilippo syndrome B
5953867 MPS IIIC - Sanfilippo syndrome C
5953871 MPS IIID - Sanfilippo syndrome D
5953866 MPS IV - Morquio syndrome A
5953873 MPS IV - Morquio syndrome B
5953862 MPS IX - Natowicz syndrome
5953865 MPS VI - Maroteaux-Lamy syndrome
5953868 MPS VII - Sly syndrome
5953250 Metabolism
5953249 Metabolism of carbohydrates
5953345 Metabolism of proteins
5953863 Mucopolysaccharidoses
5953251 Myoclonic epilepsy of Lafora
5954369 O-linked glycosylation
5954368 O-linked glycosylation of mucins
5953728 Post-translational protein modification

Domain Information

InterPro Annotations

Accession Description
IPR002659 Glycosyl transferase, family 31

UniProt Annotations

Entry Information

Gene Name
UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4
Protein Entry
D4A3H6_RAT
UniProt ID
D4A3H6
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013029 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157786938 RefSeq NP_001099408 349 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 precursor

Identical Sequences to LMP013029 proteins

Reference Database Accession Length Protein Name
GI:157786938 GenBank EDM13635.1 349 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 (predicted) [Rattus norvegicus]
GI:157786938 RefSeq XP_006249397.1 349 PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 isoform X1 [Rattus norvegicus]
GI:157786938 RefSeq XP_006249398.1 349 PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 isoform X1 [Rattus norvegicus]

Related Sequences to LMP013029 proteins

Reference Database Accession Length Protein Name
GI:157786938 GenBank AAI14988.1 350 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 [Mus musculus]
GI:157786938 GenBank EDM13635.1 349 UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 (predicted) [Rattus norvegicus]
GI:157786938 RefSeq XP_006249397.1 349 PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 isoform X1 [Rattus norvegicus]
GI:157786938 RefSeq XP_006249398.1 349 PREDICTED: UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4 isoform X1 [Rattus norvegicus]