Gene/Proteome Database (LMPD)

LMPD ID
LMP013023
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Symbol
Alternate Names
beta-1,3-galactosyltransferase 5;
Chromosome
11
Map Location
11q11

Proteins

beta-1,3-galactosyltransferase 5
Refseq ID NP_001099357
Protein GI 157786822
UniProt ID D4AB20
mRNA ID NM_001105887
Length 308
MAHMKTRLLYASVLTMGALCLYFSMESFQELPFVFKKSHGKFLQLPEIDCKQKPPFLVLLVTSSHKQLAARMAIRKTWGRETSVQGQPVRTFFLLGSSDSTEDMDATALESEQHRDIIQKDFKDAYFNLTLKTMMGMEWVYHFCPQTAYVMKTDSDMFVNVGYLTELLLKKNKTTRFFTGYIKPHDFPIRQKFNKWFVSKFEYPWDRYPPFCSGTGYVFSSDVAIQVYNVSESVPFIKLEDVFVGLCLAKLKIRPEELHTKQTFFPGGLRFSVCRFQKIVACHFMKPQDLLTYWQALETSKDEDCPAV

Gene Information

Entrez Gene ID
Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 IEA:UniProtKB-KW C Golgi apparatus
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0008378 IEA:InterPro F galactosyltransferase activity
GO:0006486 IEA:InterPro P protein glycosylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00603 Glycosphingolipid biosynthesis - globo series
rno00603 Glycosphingolipid biosynthesis - globo series
ko00601 Glycosphingolipid biosynthesis - lacto and neolacto series
rno00601 Glycosphingolipid biosynthesis - lacto and neolacto series
M00070 Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
rno01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR002659 Glycosyl transferase, family 31
IPR029044 Nucleotide-diphospho-sugar transferases

UniProt Annotations

Entry Information

Gene Name
UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 5
Protein Entry
D4AB20_RAT
UniProt ID
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP013023 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157786822 RefSeq NP_001099357 308 beta-1,3-galactosyltransferase 5

Identical Sequences to LMP013023 proteins

Reference Database Accession Length Protein Name
GI:157786822 GenBank EDL76658.1 308 rCG53114 [Rattus norvegicus]
GI:157786822 RefSeq XP_008766791.1 308 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Rattus norvegicus]
GI:157786822 RefSeq XP_008766792.1 308 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Rattus norvegicus]

Related Sequences to LMP013023 proteins

Reference Database Accession Length Protein Name
GI:157786822 GenBank EDL76658.1 308 rCG53114 [Rattus norvegicus]
GI:157786822 RefSeq XP_006523179.1 308 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Mus musculus]
GI:157786822 RefSeq XP_008766791.1 308 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Rattus norvegicus]
GI:157786822 RefSeq XP_008766792.1 308 PREDICTED: beta-1,3-galactosyltransferase 5 isoform X1 [Rattus norvegicus]