Gene/Proteome Database (LMPD)

LMPD ID
LMP012957
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
aldo-keto reductase family 1, member D1
Gene Symbol
Alternate Names
3-oxo-5-beta-steroid 4-dehydrogenase; delta(4)-3-oxosteroid 5-beta-reductase; delta(4)-3-ketosteroid 5-beta-reductase; aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase);
Chromosome
4
Map Location
4q22
EC Number
1.3.1.3
Summary
enzyme that catalyzes the reduction of key intermediates during bile acid biosynthesis [RGD, Feb 2006]
Orthologs

Proteins

3-oxo-5-beta-steroid 4-dehydrogenase
Refseq ID NP_620239
Protein GI 20302063
UniProt ID P31210
mRNA ID NM_138884
Length 326
MNLSTANHHIPLNDGNSIPIIGLGTYSDPRPVPGKTFIAVKTAIDEGYRHIDGAYVYRNEHEVGEAIREKVAEGKVKREEIFYCGKLWSTDHDPEMVRPALERTLQTLKLDYIDLYIIEMPMAFKPGEEFYPKDENGRVIYHKSNLCATWEALEACKDAGLVKSLGVSNFNRRQLEVILNKPGLKYKPVTNQVECHPYFTQTKLLEVSASSMTSFIVAYSPLGTCRNPLWVNVSSPPLLKDELLTSLGKKYNKTQAQIVLRFDIQRGLVVIPKSTTPERIKENFQIFDFSLTKEEMKDIEALNKNVRFVEMLMWSDHPEYPFHDEY

Gene Information

Entrez Gene ID
Gene Name
aldo-keto reductase family 1, member D1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0047568 IDA:MGI F 3-oxo-5-beta-steroid 4-dehydrogenase activity
GO:0047787 IEA:UniProtKB-EC F delta4-3-oxosteroid 5beta-reductase activity
GO:0030573 IEA:UniProtKB-KW P bile acid catabolic process

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00120 Primary bile acid biosynthesis
rno00120 Primary bile acid biosynthesis
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis

BIOCYC Pathway Links

BIOCYC Pathway ID Description
PWY-6061 bile acid biosynthesis, neutral pathway

Domain Information

InterPro Annotations

Accession Description
IPR001395 Aldo/keto reductase
IPR020471 Aldo/keto reductase subgroup
IPR018170 Aldo/keto reductase, conserved site
IPR023210 NADP-dependent oxidoreductase domain

UniProt Annotations

Entry Information

Gene Name
aldo-keto reductase family 1, member D1
Protein Entry
AK1D1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity 17,21-dihydroxy-5-beta-pregnane-3,11,20-trione + NADP(+) = cortisone.
Catalytic Activity 5-beta-cholestan-3-one + NADP(+) = cholest-4- en-3-one + NADPH.
Function Efficiently catalyzes the reduction of progesterone, androstenedione, 17-alpha-hydroxyprogesterone and testosterone to 5-beta-reduced metabolites. The bile acid intermediates 7- alpha,12-alpha-dihydroxy-4-cholesten-3-one and 7-alpha-hydroxy-4- cholesten-3-one can also act as substrates.
Ptm The N-terminus is blocked.
Similarity Belongs to the aldo/keto reductase family
Subcellular Location Cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP012957 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20302063 RefSeq NP_620239 326 3-oxo-5-beta-steroid 4-dehydrogenase

Identical Sequences to LMP012957 proteins

Reference Database Accession Length Protein Name
GI:20302063 DBBJ BAA04131.1 326 delta-4-3-ketosteroid 5-beta-reductase [Rattus norvegicus]
GI:20302063 GenBank AAB35916.2 326 delta 4-3-ketosteroid 5 beta-reductase [Rattus sp.]
GI:20302063 SwissProt P31210.1 326 RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase; AltName: Full=Aldo-keto reductase family 1 member D1; AltName: Full=Delta(4)-3-ketosteroid 5-beta-reductase; AltName: Full=Delta(4)-3-oxosteroid 5-beta-reductase [Rattus norvegicus]

Related Sequences to LMP012957 proteins

Reference Database Accession Length Protein Name
GI:20302063 DBBJ BAA04131.1 326 delta-4-3-ketosteroid 5-beta-reductase [Rattus norvegicus]
GI:20302063 GenBank AAB35916.2 326 delta 4-3-ketosteroid 5 beta-reductase [Rattus sp.]
GI:20302063 GenBank EDM15344.1 325 rCG27878 [Rattus norvegicus]
GI:20302063 SwissProt P31210.1 326 RecName: Full=3-oxo-5-beta-steroid 4-dehydrogenase; AltName: Full=Aldo-keto reductase family 1 member D1; AltName: Full=Delta(4)-3-ketosteroid 5-beta-reductase; AltName: Full=Delta(4)-3-oxosteroid 5-beta-reductase [Rattus norvegicus]