Gene/Proteome Database (LMPD)

LMPD ID
LMP012956
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
prostaglandin reductase 1
Gene Symbol
Synonyms
Dig1; Ltb4dh;
Alternate Names
prostaglandin reductase 1; DIG-1; PRG-1; D3T-inducible gene 1 protein; dithiolethione-inducible gene-1; 15-oxoprostaglandin 13-reductase; leukotriene B4 12-hydroxydehydrogenase; dithiolethione-inducible gene 1 protein; NADP-dependent leukotriene B4 12-hydroxydehydrogenase;
Chromosome
5
Map Location
5q24
EC Number
1.3.1.-
Summary
may play a role in inhibition of chemically induced tumorigenesis [RGD, Feb 2006]
Orthologs

Proteins

prostaglandin reductase 1
Refseq ID NP_620218
Protein GI 20302022
UniProt ID P97584
mRNA ID NM_138863
Length 329
MVQAKTWTLKKHFEGFPTDSNFELRTTELPPLNNGEVLLEALFLSVDPYMRVAAKKLKEGDSMMGEQVARVVESKNSAFPTGTIVVALLGWTSHSISDGNGLRKLPAEWPDKLPLSLALGTVGMPGLTAYFGLLDICGLKGGETVLVNAAAGAVGSVVGQIAKLKGCKVVGTAGSDEKVAYLKKLGFDVAFNYKTVKSLEEALRTASPDGYDCYFDNVGGEFSNTVILQMKTFGRIAICGAISQYNRTGPCPPGPSPEVIIYQQLRMEGFIVTRWQGEVRQKALTDLMNWVSEGKIRYHEYITEGFEKMPAAFMGMLKGDNLGKTIVKA

Gene Information

Entrez Gene ID
Gene Name
prostaglandin reductase 1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0036132 IEA:UniProtKB-EC F 13-prostaglandin reductase activity
GO:0047522 IEA:UniProtKB-EC F 15-oxoprostaglandin 13-oxidase activity
GO:0032440 IEA:UniProtKB-EC F 2-alkenal reductase [NAD(P)] activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0009636 IEP:RGD P response to toxic substance

REACTOME Pathway Links

REACTOME Pathway ID Description
5953493 Arachidonic acid metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954082 Synthesis of Leukotrienes (LT) and Eoxins (EX)
5954552 Synthesis of Lipoxins (LX)
5953492 Synthesis of Prostaglandins (PG) and Thromboxanes (TX)

Domain Information

InterPro Annotations

Accession Description
IPR002085 Alcohol dehydrogenase superfamily, zinc-type
IPR013149 Alcohol dehydrogenase, C-terminal
IPR011032 GroES (chaperonin 10)-like
IPR014190 Leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase
IPR016040 NAD(P)-binding domain

UniProt Annotations

Entry Information

Gene Name
prostaglandin reductase 1
Protein Entry
PTGR1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity 11-alpha-hydroxy-9,15-dioxoprost-5-enoate + NAD(P)(+) = (5Z)-(13E)-11-alpha-hydroxy-9,15-dioxoprosta-5,13- dienoate + NAD(P)H.
Catalytic Activity A n-alkanal + NAD(P)(+) = an alk-2-enal + NAD(P)H.
Function Functions as 15-oxo-prostaglandin 13-reductase and acts on 15-oxo-PGE1, 15-oxo-PGE2 and 15-oxo-PGE2-alpha. Has no activity towards PGE1, PGE2 and PGE2-alpha. Catalyzes the conversion of leukotriene B4 into its biologically less active metabolite, 12- oxo-leukotriene B4. This is an initial and key step of metabolic inactivation of leukotriene B4 (By similarity)
Induction Up-regulated by 1,2-dithiole-3-thione (D3T)
Similarity Belongs to the NADP-dependent oxidoreductase L4BD family
Subcellular Location Cytoplasm .
Subunit Monomer or homodimer

Identical and Related Proteins

Unique RefSeq proteins for LMP012956 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
20302022 RefSeq NP_620218 329 prostaglandin reductase 1

Identical Sequences to LMP012956 proteins

Reference Database Accession Length Protein Name
GI:20302022 GenBank AAB88912.2 329 dithiolethione-inducible gene-1 [Rattus norvegicus]
GI:20302022 GenBank AAH89775.1 329 Prostaglandin reductase 1 [Rattus norvegicus]
GI:20302022 SwissProt P97584.3 329 RecName: Full=Prostaglandin reductase 1; Short=PRG-1; AltName: Full=15-oxoprostaglandin 13-reductase; AltName: Full=Dithiolethione-inducible gene 1 protein; Short=D3T-inducible gene 1 protein; Short=DIG-1; AltName: Full=NADP-dependent leukotriene B4 12-hydroxydehydrogenase [Rattus norvegicus]

Related Sequences to LMP012956 proteins

Reference Database Accession Length Protein Name
GI:20302022 GenBank AAB88912.2 329 dithiolethione-inducible gene-1 [Rattus norvegicus]
GI:20302022 GenBank AAH89775.1 329 Prostaglandin reductase 1 [Rattus norvegicus]
GI:20302022 GenBank ADL96436.1 329 Sequence 1 from patent US 7718385
GI:20302022 SwissProt P97584.3 329 RecName: Full=Prostaglandin reductase 1; Short=PRG-1; AltName: Full=15-oxoprostaglandin 13-reductase; AltName: Full=Dithiolethione-inducible gene 1 protein; Short=D3T-inducible gene 1 protein; Short=DIG-1; AltName: Full=NADP-dependent leukotriene B4 12-hydroxydehydrogenase [Rattus norvegicus]