Gene/Proteome Database (LMPD)

LMPD ID
LMP012929
Gene ID
170919
Species
Rattus norvegicus (Rat)
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4
Gene Symbol
Agpat4
Alternate Names
1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-AGPAT 4; LPAAT-delta; 1-AGP acyltransferase 4; lysophosphatidic acid acyltransferase delta; 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase delta); 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acid acyltransferase, delta); 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta);
Chromosome
1
Map Location
1q11
EC Number
2.3.1.51
Summary
lysophosphatidic acid acyltransferase [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Agpat4

Proteins

1-acyl-sn-glycerol-3-phosphate acyltransferase delta
Refseq ID NP_596897
Protein GI 19173770
UniProt ID Q924S1
mRNA ID NM_133406
Length 378
MDLIGLLKSQFLCHLVFCYVFIASGLIVNAIQLCTLVIWPINKQLFRKINARLCYCVSSQLVMLLEWWSGTECTIYTDPKASPHYGKENAIVVLNHKFEIDFLCGWSLAERLGILGNSKVLAKKELAYVPIIGWMWYFVEMIFCTRKWEQDRQTVAKSLLHLRDYPEKYLFLIHCEGTRFTEKKHQISMQVAQAKGLPSLKHHLLPRTKGFAITVKCLRDVVPAVYDCTLNFRNNENPTLLGVLNGKKYHADCYVRRIPMEDIPEDEDKCSAWLHKLYQEKDAFQEEYYRTGVFPETPWVPPRRPWSLVNWLFWASLLLYPFFQFLVSMVSSGSSVTLASLVLIFCMASMGVRWMIGVTEIDKGSAYGNIDNKRKQTD

Gene Information

Entrez Gene ID
170919
Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4
Gene Symbol
Agpat4
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0003841 IEA:UniProtKB-EC F 1-acylglycerol-3-phosphate O-acyltransferase activity
GO:0016024 IEA:UniProtKB-UniPathway P CDP-diacylglycerol biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko00561 Glycerolipid metabolism
rno00561 Glycerolipid metabolism
ko00564 Glycerophospholipid metabolism
rno00564 Glycerophospholipid metabolism
rno01100 Metabolic pathways
M00089 Triacylglycerol biosynthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5953473 Glycerophospholipid biosynthesis
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953474 Phospholipid metabolism
5953472 Synthesis of PA
5953464 Triglyceride Biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR002123 Phospholipid/glycerol acyltransferase

UniProt Annotations

Entry Information

Gene Name
1-acylglycerol-3-phosphate O-acyltransferase 4
Protein Entry
PLCD_RAT
UniProt ID
Q924S1
Species
Rat

Comments

Comment Type Description
Catalytic Activity Acyl-CoA + 1-acyl-sn-glycerol 3-phosphate = CoA + 1,2-diacyl-sn-glycerol 3-phosphate.
Domain The HXXXXD motif is essential for acyltransferase activity and may constitute the binding site for the phosphate moiety of the glycerol-3-phosphate
Function Converts lysophosphatidic acid (LPA) into phosphatidic acid by incorporating an acyl moiety at the sn-2 position of the glycerol backbone
Pathway Phospholipid metabolism; CDP-diacylglycerol biosynthesis; CDP-diacylglycerol from sn-glycerol 3-phosphate: step 2/3.
Similarity Belongs to the 1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location Membrane ; Multi-pass membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP012929 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
19173770 RefSeq NP_596897 378 1-acyl-sn-glycerol-3-phosphate acyltransferase delta

Identical Sequences to LMP012929 proteins

Reference Database Accession Length Protein Name
GI:19173770 GenBank AAH86992.1 378 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Rattus norvegicus]
GI:19173770 GenBank EDL83076.1 378 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta), isoform CRA_a [Rattus norvegicus]
GI:19173770 GenBank EDL83077.1 378 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta), isoform CRA_a [Rattus norvegicus]
GI:19173770 RefSeq XP_006227919.1 378 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta isoform X1 [Rattus norvegicus]

Related Sequences to LMP012929 proteins

Reference Database Accession Length Protein Name
GI:19173770 GenBank AAH86992.1 378 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta) [Rattus norvegicus]
GI:19173770 GenBank EDL83076.1 378 1-acylglycerol-3-phosphate O-acyltransferase 4 (lysophosphatidic acid acyltransferase, delta), isoform CRA_a [Rattus norvegicus]
GI:19173770 RefSeq XP_006227919.1 378 PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase delta isoform X1 [Rattus norvegicus]
GI:19173770 SwissProt Q924S1.1 378 RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase delta; AltName: Full=1-acylglycerol-3-phosphate O-acyltransferase 4; Short=1-AGP acyltransferase 4; Short=1-AGPAT 4; AltName: Full=Lysophosphatidic acid acyltransferase delta; Short=LPAAT-delta [Rattus norvegicus]