Gene/Proteome Database (LMPD)

LMPD ID
LMP012926
Gene ID
170906
Species
Rattus norvegicus (Rat)
Gene Name
zinc finger, DHHC-type containing 7
Gene Symbol
Zdhhc7
Synonyms
Serz1; Serz-1;
Alternate Names
palmitoyltransferase ZDHHC7; DHHC-7; putative zinc finger protein SERZ-1; zinc finger, DHHC domain containing 7; zinc finger DHHC domain-containing protein 7; membrane-associated DHHC7 zinc finger protein; sertoli cell gene with a zinc finger domain protein;
Chromosome
19
Map Location
19q12
EC Number
2.3.1.225
Summary
a zinc finger protein; may have a role in sertoli cell differentiation [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Zdhhc7

Proteins

palmitoyltransferase ZDHHC7
Refseq ID NP_596885
Protein GI 19173750
UniProt ID Q923G5
mRNA ID NM_133394
Length 308
MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSEADMADRVWFIRDGCGMVCAVMTWLLVVYADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSIHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLQMRTRKGGPEFSV

Gene Information

Entrez Gene ID
170906
Gene Name
zinc finger, DHHC-type containing 7
Gene Symbol
Zdhhc7
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005794 ISS:UniProtKB C Golgi apparatus
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0019706 IEA:UniProtKB-EC F protein-cysteine S-palmitoyltransferase activity
GO:0008270 IEA:InterPro F zinc ion binding
GO:0018230 ISS:UniProtKB P peptidyl-L-cysteine S-palmitoylation

Domain Information

InterPro Annotations

Accession Description
IPR001594 Zinc finger, DHHC-type, palmitoyltransferase

UniProt Annotations

Entry Information

Gene Name
zinc finger, DHHC-type containing 7
Protein Entry
ZDHC7_RAT
UniProt ID
Q923G5
Species
Rat

Comments

Comment Type Description
Catalytic Activity Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.
Domain The DHHC domain is required for palmitoyltransferase activity
Function Palmitoyltransferase with broad specificity. Palmitoylates SNAP25 and DLG4/PSD95. May palmitoylate GABA receptors on their gamma subunit (GABRG1, GABRG2 and GABRG3) and thereby regulate their synaptic clustering and/or cell surface stability (By similarity). Palmitoylates sex steroid hormone receptors, including ESR1, PGR and AR, thereby regulating their targeting to the plasma membrane. This affects rapid intracellular signaling by sex hormones via ERK and AKT kinases and the generation of cAMP, but does not affect that mediated by their nuclear receptors (By similarity). May play a role in follicle stimulation hormone (FSH) activation of testicular Sertoli cells
Similarity Belongs to the DHHC palmitoyltransferase family
Similarity Contains 1 DHHC-type zinc finger
Subcellular Location Membrane ; Multi-pass membrane protein {ECO:0000305}. Golgi apparatus .
Tissue Specificity Widely expressed. Present in Sertoli cells (at protein level)

Identical and Related Proteins

Unique RefSeq proteins for LMP012926 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
19173750 RefSeq NP_596885 308 palmitoyltransferase ZDHHC7

Identical Sequences to LMP012926 proteins

Reference Database Accession Length Protein Name
GI:19173750 GenBank AAH61769.1 308 Zinc finger, DHHC-type containing 7 [Rattus norvegicus]
GI:19173750 GenBank AAX73387.1 308 membrane-associated DHHC7 zinc finger protein [Rattus norvegicus]
GI:19173750 GenBank EDL92694.1 308 zinc finger, DHHC domain containing 7, isoform CRA_b [Rattus norvegicus]
GI:19173750 SwissProt Q923G5.1 308 RecName: Full=Palmitoyltransferase ZDHHC7; AltName: Full=Sertoli cell gene with a zinc finger domain protein; AltName: Full=Zinc finger DHHC domain-containing protein 7; Short=DHHC-7 [Rattus norvegicus]

Related Sequences to LMP012926 proteins

Reference Database Accession Length Protein Name
GI:19173750 GenBank AAH61769.1 308 Zinc finger, DHHC-type containing 7 [Rattus norvegicus]
GI:19173750 GenBank EDL92694.1 308 zinc finger, DHHC domain containing 7, isoform CRA_b [Rattus norvegicus]
GI:19173750 SwissProt Q923G5.1 308 RecName: Full=Palmitoyltransferase ZDHHC7; AltName: Full=Sertoli cell gene with a zinc finger domain protein; AltName: Full=Zinc finger DHHC domain-containing protein 7; Short=DHHC-7 [Rattus norvegicus]