Gene/Proteome Database (LMPD)

LMPD ID
LMP012878
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
post-GPI attachment to proteins 2
Gene Symbol
Synonyms
Frag1;
Alternate Names
post-GPI attachment to proteins factor 2; FGF receptor activating protein 1; FGF receptor-activating protein 1; post-GPI-attachment to proteins 2;
Chromosome
1
Map Location
1q32
Summary
stimulates transforming activity and autophosphorylation of the receptor [RGD, Feb 2006]
Orthologs

Proteins

post-GPI attachment to proteins factor 2
Refseq ID NP_446347
Protein GI 16758956
UniProt ID Q2ABP3
mRNA ID NM_053895
Length 254
MYQVPLTLDRDGTLVRLRFTMVALITVCCPLVAFFFCILWSLLFHFKETTSTHCGVPNYLPSVSSAIGGEVPQRYVWRFCIGLHSAPRFLTAFAYWNHYLSCASPCPGYRLLCRLNFSLNVVENLALLVLTYVSSSEDFTIHENAFIVFIAASLSYMLLTCILWRLTKKHTDRKSYSWKQRLFIINFISFFSALAVYFRHNMYCEAGVYTIFAILEYTVVLTNMAFHMTAWWDFGNKELLITSQPGKRDSKPRL

Gene Information

Entrez Gene ID
Gene Name
post-GPI attachment to proteins 2
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000139 IDA:UniProtKB C Golgi membrane
GO:0005789 IDA:UniProtKB C endoplasmic reticulum membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005634 IEA:Ensembl C nucleus
GO:0008565 IMP:UniProtKB F protein transporter activity
GO:0006506 IMP:UniProtKB P GPI anchor biosynthetic process
GO:0042771 IEA:Ensembl P intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator
GO:1902230 IEA:Ensembl P negative regulation of intrinsic apoptotic signaling pathway in response to DNA damage
GO:0015031 IMP:GOC P protein transport
GO:0042770 IEA:Ensembl P signal transduction in response to DNA damage

Domain Information

InterPro Annotations

Accession Description
IPR019402 Frag1/DRAM/Sfk1

UniProt Annotations

Entry Information

Gene Name
post-GPI attachment to proteins 2
Protein Entry
PGAP2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q2ABP3-1; Sequence=Displayed; Name=2; IsoId=Q2ABP3-2; Sequence=VSP_032554;
Function Involved in the lipid remodeling steps of GPI-anchor maturation. Required for stable expression of GPI-anchored proteins at the cell surface
Miscellaneous In osteosarcoma cells, a chromosomal translocation with FGFR2 results in an in-frame fusion of the two genes. This generates FGFR2-ROS, a chimeric protein with transforming activity.
Sequence Caution Sequence=AAB07050.1; Type=Frameshift; Positions=250; Evidence= ;
Similarity Belongs to the PGAP2 family
Subcellular Location Golgi apparatus membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.
Subunit Interacts with PGAP2IP
Tissue Specificity Expressed in heart, brain, spleen, lung, liver, skeletal muscle, kidney and testis

Identical and Related Proteins

Unique RefSeq proteins for LMP012878 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758956 RefSeq NP_446347 254 post-GPI attachment to proteins factor 2

Identical Sequences to LMP012878 proteins

Reference Database Accession Length Protein Name
GI:16758956 GenBank AAB07050.1 254 FGF receptor activating protein FRAG1 [Rattus norvegicus]

Related Sequences to LMP012878 proteins

Reference Database Accession Length Protein Name
GI:16758956 GenBank AAB07050.1 254 FGF receptor activating protein FRAG1 [Rattus norvegicus]
GI:16758956 GenBank AAO30842.1 254 Sequence 6 from patent US 6323316
GI:16758956 GenBank ABY03250.1 254 Sequence 6 from patent US 7297493