Gene/Proteome Database (LMPD)

LMPD ID
LMP012866
Gene ID
114597
Species
Rattus norvegicus (Rat)
Gene Name
succinate-CoA ligase, alpha subunit
Gene Symbol
Suclg1
Alternate Names
succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; SCS-alpha; succinyl-CoA synthetase alpha subunit; succinyl-CoA synthetase subunit alpha; succinate-CoA ligase, GDP-forming alpha subunit; succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial;
Chromosome
4
Map Location
4q33
EC Number
6.2.1.4
Summary
alpha subunit of succinate-CoA ligase, which catalyzes the conversion of succinate and CoA to succinyl-CoA in the tricarboxylic acid cycle [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Suclg1

Proteins

succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial precursor
Refseq ID NP_446204
Protein GI 139948224
UniProt ID P13086
mRNA ID NM_053752
Length 346
MTAAVVAAAATATMVSGSSGLAAARLLSRTFLLQQNGIRHGSYTASRKNIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGKKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHKLTRQGKTRLIGPNCPGIINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLDVFLKDPATEGIVLIGEIGGHAEENAAEFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVIVSMSPAQLGTCMYKEFEKRKML
transit_peptide: 1..40 experiment: experimental evidence, no additional details recorded note: Mitochondrion; propagated from UniProtKB/Swiss-Prot (P13086.2) calculated_mol_wt: 4015 peptide sequence: MTAAVVAAAATATMVSGSSGLAAARLLSRTFLLQQNGIRH mat_peptide: 41..346 product: Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P13086.2) calculated_mol_wt: 32151 peptide sequence: GSYTASRKNIYIDKNTKVICQGFTGKQGTFHSQQALEYGTKLVGGTTPGKGGKKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEAIDAEIPLVVCITEGIPQQDMVRVKHKLTRQGKTRLIGPNCPGIINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLDVFLKDPATEGIVLIGEIGGHAEENAAEFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVIVSMSPAQLGTCMYKEFEKRKML

Gene Information

Entrez Gene ID
114597
Gene Name
succinate-CoA ligase, alpha subunit
Gene Symbol
Suclg1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005743 IEA:Ensembl C mitochondrial inner membrane
GO:0005739 IDA:RGD C mitochondrion
GO:0043234 IDA:RGD C protein complex
GO:0045244 IDA:RGD C succinate-CoA ligase complex (GDP-forming)
GO:0003878 IEA:InterPro F ATP citrate synthase activity
GO:0019003 IDA:RGD F GDP binding
GO:0005525 IEA:UniProtKB-KW F GTP binding
GO:0048037 IEA:InterPro F cofactor binding
GO:0044822 IEA:Ensembl F poly(A) RNA binding
GO:0046982 IDA:RGD F protein heterodimerization activity
GO:0004775 IDA:RGD F succinate-CoA ligase (ADP-forming) activity
GO:0004776 IDA:RGD F succinate-CoA ligase (GDP-forming) activity
GO:0006105 IDA:RGD P succinate metabolic process
GO:0006104 IDA:RGD P succinyl-CoA metabolic process
GO:0006099 IDA:RGD P tricarboxylic acid cycle

KEGG Pathway Links

KEGG Pathway ID Description
ko01200 Carbon metabolism
rno01200 Carbon metabolism
ko00020 Citrate cycle (TCA cycle)
rno00020 Citrate cycle (TCA cycle)
M00009 Citrate cycle (TCA cycle, Krebs cycle)
M00011 Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rno01100 Metabolic pathways
ko00640 Propanoate metabolism
rno00640 Propanoate metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5953285 Citric acid cycle (TCA cycle)
5953250 Metabolism
5953269 Pyruvate metabolism and Citric Acid (TCA) cycle
5953270 The citric acid (TCA) cycle and respiratory electron transport

Domain Information

InterPro Annotations

Accession Description
IPR005811 ATP-citrate lyase/succinyl-CoA ligase
IPR017440 ATP-citrate lyase/succinyl-CoA ligase, active site
IPR003781 CoA-binding
IPR016040 NAD(P)-binding domain
IPR005810 Succinyl-CoA ligase, alpha subunit
IPR016102 Succinyl-CoA synthetase-like

UniProt Annotations

Entry Information

Gene Name
succinate-CoA ligase, alpha subunit
Protein Entry
SUCA_RAT
UniProt ID
P13086
Species
Rat

Comments

Comment Type Description
Catalytic Activity ATP + succinate + CoA = ADP + phosphate + succinyl-CoA.
Catalytic Activity GTP + succinate + CoA = GDP + phosphate + succinyl-CoA.
Function Catalyzes the ATP- or GTP-dependent ligation of succinate and CoA to form succinyl-CoA. The nature of the beta subunit determines the nucleotide specificity (By similarity)
Pathway Carbohydrate metabolism; tricarboxylic acid cycle.
Sequence Caution Sequence=AAA41233.1; Type=Miscellaneous discrepancy; Note=Chimeric cDNA.; Evidence= ;
Similarity Belongs to the succinate/malate CoA ligase alpha subunit family
Subcellular Location Mitochondrion.
Subunit Heterodimer of an alpha and a beta subunit.

Identical and Related Proteins

Unique RefSeq proteins for LMP012866 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
139948224 RefSeq NP_446204 346 succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial precursor

Identical Sequences to LMP012866 proteins

Reference Database Accession Length Protein Name
GI:139948224 GenBank AAH61537.2 346 Suclg1 protein [Rattus norvegicus]
GI:139948224 SwissProt P13086.2 346 RecName: Full=Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012866 proteins

Reference Database Accession Length Protein Name
GI:139948224 GenBank AAH61537.2 346 Suclg1 protein [Rattus norvegicus]
GI:139948224 GenBank EDL91059.1 360 succinate-CoA ligase, GDP-forming, alpha subunit, isoform CRA_b [Rattus norvegicus]
GI:139948224 SwissProt P13086.2 346 RecName: Full=Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; AltName: Full=Succinyl-CoA synthetase subunit alpha; Short=SCS-alpha; Flags: Precursor [Rattus norvegicus]