Gene/Proteome Database (LMPD)

LMPD ID
LMP012855
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
cysteinyl leukotriene receptor 1
Gene Symbol
Synonyms
Cyslt1;
Alternate Names
cysteinyl leukotriene receptor 1;
Chromosome
X
Map Location
Xq31
Summary
plays a role in the development of eosinophilic airway inflammation [RGD, Feb 2006]
Orthologs

Proteins

cysteinyl leukotriene receptor 1
Refseq ID NP_446093
Protein GI 16758452
UniProt ID Q924T8
mRNA ID NM_053641
Length 339
MVGAENMTASFSNNRCHDTIDEFRNQVYSTMYSMISVVGFFGNSFVLYVLIKTYHEKSAFQVYMINLAIADLLCVCTLPLRVVYYVHKGKWFFGDFLCRLTTYALYVNLYCSIFFMTAMSFFRCVAIVFPVQNINLVTQKKARFVCVGIWIFVILTSSPFLLSKSYQDEKNNTKCFEPPQDKQTKKYVLVLHYVSLIFGFIIPFVTIIVCYTMIILTLLKNTMKKNLPSRRKAIGMIIVVTAAFLVSFMPYHIQRAIHLHFLHSETRSCDSVLRMQKSVVITLSLAASNCCFDPLLYFFSGGNFRRRLSTFRKHSLSSMTYIPKKKASLPEKGEEMCKE

Gene Information

Entrez Gene ID
Gene Name
cysteinyl leukotriene receptor 1
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005887 IEA:Ensembl C integral component of plasma membrane
GO:0004974 IDA:RGD F leukotriene receptor activity
GO:0006816 IEA:Ensembl P calcium ion transport
GO:0006935 IEA:Ensembl P chemotaxis
GO:0006954 IDA:RGD P inflammatory response
GO:0045766 IMP:RGD P positive regulation of angiogenesis
GO:0045907 IMP:RGD P positive regulation of vasoconstriction

KEGG Pathway Links

KEGG Pathway ID Description
ko04020 Calcium signaling pathway
rno04020 Calcium signaling pathway
ko04080 Neuroactive ligand-receptor interaction
rno04080 Neuroactive ligand-receptor interaction

REACTOME Pathway Links

REACTOME Pathway ID Description
5954122 Class A/1 (Rhodopsin-like receptors)
5954202 Eicosanoid ligand-binding receptors
5953653 G alpha (q) signalling events
5953642 GPCR downstream signaling
5953758 GPCR ligand binding
5953537 Gastrin-CREB signalling pathway via PKC and MAPK
5954203 Leukotriene receptors
5953381 Signal Transduction
5953391 Signaling by GPCR

Domain Information

InterPro Annotations

Accession Description
IPR004071 Cysteinyl leukotriene receptor
IPR013310 Cysteinyl leukotriene receptor 1
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM

UniProt Annotations

Entry Information

Gene Name
cysteinyl leukotriene receptor 1
Protein Entry
CLTR1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Function Receptor for cysteinyl leukotrienes mediating constriction of the microvascular smooth muscle during an inflammatory response. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system (By similarity)
Similarity Belongs to the G-protein coupled receptor 1 family
Subcellular Location Cell membrane; Multi-pass membrane protein.

Identical and Related Proteins

Unique RefSeq proteins for LMP012855 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
16758452 RefSeq NP_446093 339 cysteinyl leukotriene receptor 1

Identical Sequences to LMP012855 proteins

Reference Database Accession Length Protein Name
GI:16758452 DBBJ BAB60825.1 339 CysLT1 receptor [Rattus norvegicus]
GI:16758452 RefSeq XP_006257220.1 339 PREDICTED: cysteinyl leukotriene receptor 1 isoform X1 [Rattus norvegicus]
GI:16758452 SwissProt Q924T8.1 339 RecName: Full=Cysteinyl leukotriene receptor 1; Short=CysLTR1 [Rattus norvegicus]

Related Sequences to LMP012855 proteins

Reference Database Accession Length Protein Name
GI:16758452 DBBJ BAB60825.1 339 CysLT1 receptor [Rattus norvegicus]
GI:16758452 RefSeq XP_006257220.1 339 PREDICTED: cysteinyl leukotriene receptor 1 isoform X1 [Rattus norvegicus]
GI:16758452 SwissProt Q924T8.1 339 RecName: Full=Cysteinyl leukotriene receptor 1; Short=CysLTR1 [Rattus norvegicus]