Gene/Proteome Database (LMPD)

LMPD ID
LMP012845
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
glutathione peroxidase 5
Gene Symbol
Alternate Names
epididymal secretory glutathione peroxidase; EGLP; GPx-5; GSHPx-5; epididymis-specific glutathione peroxidase-like protein;
Chromosome
17
Map Location
17q11
EC Number
1.11.1.9
Summary
enzyme that catalyzes the reduction of lipid peroxides; has a role in the hydrogen peroxide scavenging system found within the epididymis [RGD, Feb 2006]
Orthologs

Proteins

epididymal secretory glutathione peroxidase precursor
Refseq ID NP_001099208
Protein GI 157786758
UniProt ID P30710
mRNA ID NM_001105738
Length 221
MAIQLRVFYLVPLLLASYVQTTPRLEKMKMDCYKDVKGTIYNYEALSLNGKERIPFKQYAGKHVLFVNVATYCGLTIQYPELNALQDDLKQFGLVILGFPCNQFGKQEPGDNTEILPGLKYVRPGKGFLPNFQLFAKGDVNGEKEQEIFTFLKRSCPHPSETVVTSKHTFWEPIKVHDIRWNFEKFLVGPNGVPVMRWFHQAPVSTVKSDILAYLNQFKTI
sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2439 peptide sequence: MAIQLRVFYLVPLLLASYVQT mat_peptide: 22..221 product: Epididymal secretory glutathione peroxidase experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P30710.1) calculated_mol_wt: 22964 peptide sequence: TPRLEKMKMDCYKDVKGTIYNYEALSLNGKERIPFKQYAGKHVLFVNVATYCGLTIQYPELNALQDDLKQFGLVILGFPCNQFGKQEPGDNTEILPGLKYVRPGKGFLPNFQLFAKGDVNGEKEQEIFTFLKRSCPHPSETVVTSKHTFWEPIKVHDIRWNFEKFLVGPNGVPVMRWFHQAPVSTVKSDILAYLNQFKTI

Gene Information

Entrez Gene ID
Gene Name
glutathione peroxidase 5
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005576 IEA:UniProtKB-KW C extracellular region
GO:0004602 IEA:UniProtKB-EC F glutathione peroxidase activity
GO:0006979 IEA:InterPro P response to oxidative stress

KEGG Pathway Links

KEGG Pathway ID Description
ko00590 Arachidonic acid metabolism
rno00590 Arachidonic acid metabolism
ko00480 Glutathione metabolism
rno00480 Glutathione metabolism
ko04918 Thyroid hormone synthesis
rno04918 Thyroid hormone synthesis

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029759 Glutathione peroxidase active site
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 5
Protein Entry
GPX5_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity 2 glutathione + H(2)O(2) = glutathione disulfide + 2 H(2)O.
Function Protects cells and enzymes from oxidative damage, by catalyzing the reduction of hydrogen peroxide, lipid peroxides and organic hydroperoxide, by glutathione. May constitute a glutathione peroxidase-like protective system against peroxide damage in sperm membrane lipids.
Similarity Belongs to the glutathione peroxidase family
Subcellular Location Secreted.
Tissue Specificity Epididymis.

Identical and Related Proteins

Unique RefSeq proteins for LMP012845 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
157786758 RefSeq NP_001099208 221 epididymal secretory glutathione peroxidase precursor

Identical Sequences to LMP012845 proteins

Reference Database Accession Length Protein Name
GI:157786758 EMBL CAA44274.1 221 epididymal secretory glutathione peroxidase [Rattus rattus]
GI:157786758 GenBank EDL84536.1 221 glutathione peroxidase 5 [Rattus norvegicus]
GI:157786758 SwissProt P30710.1 221 RecName: Full=Epididymal secretory glutathione peroxidase; AltName: Full=Epididymis-specific glutathione peroxidase-like protein; Short=EGLP; AltName: Full=Glutathione peroxidase 5; Short=GPx-5; Short=GSHPx-5; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012845 proteins

Reference Database Accession Length Protein Name
GI:157786758 EMBL CAA44274.1 221 epididymal secretory glutathione peroxidase [Rattus rattus]
GI:157786758 GenBank EDL84536.1 221 glutathione peroxidase 5 [Rattus norvegicus]
GI:157786758 SwissProt P30710.1 221 RecName: Full=Epididymal secretory glutathione peroxidase; AltName: Full=Epididymis-specific glutathione peroxidase-like protein; Short=EGLP; AltName: Full=Glutathione peroxidase 5; Short=GPx-5; Short=GSHPx-5; Flags: Precursor [Rattus norvegicus]