Gene/Proteome Database (LMPD)
LMPD ID
LMP012822
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
malonyl-CoA decarboxylase
Gene Symbol
Synonyms
Mcd;
Alternate Names
malonyl-CoA decarboxylase, mitochondrial;
Chromosome
19
Map Location
19q12
EC Number
4.1.1.9
Summary
plays a role in malonyl-CoA catabolism [RGD, Feb 2006]
Orthologs
Proteins
| malonyl-CoA decarboxylase, mitochondrial | |
|---|---|
| Refseq ID | NP_445929 |
| Protein GI | 16758230 |
| UniProt ID | Q920F5 |
| mRNA ID | NM_053477 |
| Length | 491 |
| MRGLGPSLRARRLLPLRYPPRPPGPRGPRLCSGLTASAMDELLRRAVPPTPAYELREKTPAPAEGQCADFVSFYGGLAEAAQRAELLGRLAQGFGVDHGQVAEQSAGVLQLRQQSREAAVLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPHVREMNGVLKSMLSEWFSSGFLNLERVTWHSPCEVLQKISDCEAVQPVKNWMDMKRRVGPYRRCYFFSHCSTPGDPLVVLHVALTGDISNNIQSIVKECPPSETEEKNRIAAAVFYSISLTQQGLQGVGLGTFLIKRVVKELQKEFPHLGAFSSLSPIPGFTKWLLGLLNVQGKEYGRNELFTDSECKEIAEVTGDPVHESLKGLLSSGEWAKSEKLAQALQGPLMRLCAWYLYGEKHRYALNPVANFHLQNGAVMWRINWMADSSLKGLTSSCGLMVNYRYYLEETGPNSISYLGSKNIKASEQILSLVAQFQSNSKL | |
| transit_peptide: 1..38 calculated_mol_wt: 4095 peptide sequence: MRGLGPSLRARRLLPLRYPPRPPGPRGPRLCSGLTASA | |
Gene Information
Entrez Gene ID
Gene Name
malonyl-CoA decarboxylase
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IDA:UniProtKB | C | cytoplasm |
| GO:0005829 | IDA:RGD | C | cytosol |
| GO:0005759 | IDA:UniProtKB | C | mitochondrial matrix |
| GO:0005739 | IDA:RGD | C | mitochondrion |
| GO:0005782 | IDA:UniProtKB | C | peroxisomal matrix |
| GO:0005777 | IDA:UniProtKB | C | peroxisome |
| GO:0050080 | IDA:RGD | F | malonyl-CoA decarboxylase activity |
| GO:0006085 | IDA:RGD | P | acetyl-CoA biosynthetic process |
| GO:0006633 | IMP:UniProtKB | P | fatty acid biosynthetic process |
| GO:0019395 | IDA:RGD | P | fatty acid oxidation |
| GO:2001294 | ISS:UniProtKB | P | malonyl-CoA catabolic process |
| GO:0046321 | ISS:UniProtKB | P | positive regulation of fatty acid oxidation |
| GO:0031998 | IDA:RGD | P | regulation of fatty acid beta-oxidation |
| GO:0046320 | IMP:RGD | P | regulation of fatty acid oxidation |
| GO:0010906 | IMP:UniProtKB | P | regulation of glucose metabolic process |
| GO:0002931 | IMP:UniProtKB | P | response to ischemia |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| ko04152 | AMPK signaling pathway |
| rno04152 | AMPK signaling pathway |
| rno01100 | Metabolic pathways |
| ko04146 | Peroxisome |
| rno04146 | Peroxisome |
| ko00640 | Propanoate metabolism |
| rno00640 | Propanoate metabolism |
| ko00410 | beta-Alanine metabolism |
| rno00410 | beta-Alanine metabolism |
REACTOME Pathway Links
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007956 | Malonyl-CoA decarboxylase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative initiation; Named isoforms=2; Comment=According to PubMed:10229677, a single transcription start site has been demonstrated.; Name=Mitochondrial; IsoId=Q920F5-1; Sequence=Displayed; Name=Cytoplasmic+peroxisomal; IsoId=Q920F5-2; Sequence=VSP_018818; Note=May be produced by alternative initiation at Met-39 of isoform mitochondrial. Alternatively, represents a proteolytic processed form of the mitochondrial form (PubMed:10947976). ; |
| Biophysicochemical Properties | Kinetic parameters: KM=0.36 mM for malonyl-CoA ; |
| Catalytic Activity | Malonyl-CoA = acetyl-CoA + CO(2). {ECO:0000269|PubMed:10229677, ECO:0000269|PubMed:12297032, ECO:0000269|PubMed:16298369}. |
| Enzyme Regulation | Malonyl-CoA decarboxylase activity does not require any cofactors or divalent metal ions |
| Function | Catalyzes the conversion of malonyl-CoA to acetyl-CoA. In the fatty acid biosynthesis MCD selectively removes malonyl-CoA and thus assures that methyl-malonyl-CoA is the only chain elongating substrate for fatty acid synthase and that fatty acids with multiple methyl side chains are produced. In peroxisomes it may be involved in degrading intraperoxisomal malonyl-CoA, which is generated by the peroxisomal beta-oxidation of odd chain-length dicarboxylic fatty acids. Plays a role in the metabolic balance between glucose and lipid oxidation in muscle independent of alterations in insulin signaling. May play a role in controlling the extent of ischemic injury by promoting glucose oxidation. {ECO:0000269|PubMed:10947976, ECO:0000269|PubMed:15105298, ECO:0000269|PubMed:16298369}. |
| Pathway | Metabolic intermediate biosynthesis; acetyl-CoA biosynthesis; acetyl-CoA from malonyl-CoA: step 1/1. |
| Ptm | Acetylation at Lys-471 activates malonyl-CoA decarboxylase activity. Deacetylation at Lys-471 by SIRT4 represses activity, leading to promote lipogenesis (By similarity) |
| Ptm | Interchain disulfide bonds may form in peroxisomes (Potential). Interchain disulfide bonds are not expected to form in the reducing environment of the cytoplasm and mitochondria |
| Subcellular Location | Cytoplasm . Mitochondrion matrix . Peroxisome {ECO:0000250}. Peroxisome matrix . Note=Enzymatically active in all three subcellular compartments. |
| Subunit | Homotetramer. Dimer of dimers. The two subunits within a dimer display conformational differences suggesting that at any given moment, only one of the two subunits is competent for malonyl-CoA binding and catalytic activity. Under oxidizing conditions, can form disulfide-linked homotetramers (in vitro). Associates with the peroxisomal targeting signal receptor PEX5 (By similarity) |
| Tissue Specificity | Expressed in liver, heart, skeletal muscles and adipose tissues (at protein level). Ubiquitous. Strongly expressed in liver, kidney, heart, skeletal muscle and adipose tissues. Weakly expressed in brain. {ECO:0000269|PubMed:10229677, ECO:0000269|PubMed:10455107, ECO:0000269|PubMed:10947976, ECO:0000269|PubMed:12297032}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012822 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 16758230 | RefSeq | NP_445929 | 491 | malonyl-CoA decarboxylase, mitochondrial |
Identical Sequences to LMP012822 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16758230 | EMBL | CAB46681.1 | 491 | malonyl-Coa decarboxylase [Rattus norvegicus] |
Related Sequences to LMP012822 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:16758230 | EMBL | CAB46681.1 | 491 | malonyl-Coa decarboxylase [Rattus norvegicus] |
| GI:16758230 | GenBank | AAH61845.1 | 492 | Malonyl-CoA decarboxylase [Rattus norvegicus] |
| GI:16758230 | SwissProt | Q920F5.1 | 492 | RecName: Full=Malonyl-CoA decarboxylase, mitochondrial; Short=MCD; Flags: Precursor [Rattus norvegicus] |