LIPID MAPS

LMPD ID

LMP012812

Gene ID

84385

Species

Rattus norvegicus (Rat)

Gene Name

nuclear receptor subfamily 1, group I, member 2

Gene Symbol

Nr1i2

Synonyms

PXR;

Alternate Names

nuclear receptor subfamily 1 group I member 2; orphan nuclear receptor PXR; nuclear receptor subfamily 1, group 1, member 2; pregnane X receptor (nuclear receptor sub family 1, group I, member 2);

Chromosome

11

Map Location

11q21

Summary

involved in the induction of cytochrome P4503A (CYP3A) [RGD, Feb 2006]

Orthologs

View orthologs and multiple alignments for Nr1i2

nuclear receptor subfamily 1 group I member 2
Refseq ID	NP_443212
Protein GI	16418481
UniProt ID	Q9R1A7
mRNA ID	NM_052980
Length	431
MRPEERWNHVGLVQREEADSVLEEPINVDEEDGGLQICRVCGDKANGYHFNVMTCEGCKGFFRRAMKRNVRLRCPFRKGTCEITRKTRRQCQACRLRKCLESGMKKEMIMSDAAVEQRRALIKRKKREKIEAPPPGGQGLTEEQQALIQELMDAQMQTFDTTFSHFKDFRLPAVFHSDCELPEVLQASLLEDPATWSQIMKDSVPMKISVQLRGEDGSIWNYQPPSKSDGKEIIPLLPHLADVSTYMFKGVINFAKVISHFRELPIEDQISLLKGATFEMCILRFNTMFDTETGTWECGRLAYCFEDPNGGFQKLLLDPLMKFHCMLKKLQLREEEYVLMQAISLFSPDRPGVVQRSVVDQLQERFALTLKAYIECSRPYPAHRFLFLKIMAVLTELRSINAQQTQQLLRIQDTHPFATPLMQELFSSTDG

Entrez Gene ID

84385

Gene Name

nuclear receptor subfamily 1, group I, member 2

Gene Symbol

Nr1i2

Species

Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0005634	IEA:UniProtKB-KW	C	nucleus
GO:0000977	IEA:Ensembl	F	RNA polymerase II regulatory region sequence-specific DNA binding
GO:0001228	IEA:Ensembl	F	RNA polymerase II transcription regulatory region sequence-specific DNA binding transcription factor activity involved in positive regulation of transcription
GO:0008144	ISS:UniProtKB	F	drug binding
GO:0004879	ISS:UniProtKB	F	ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activity
GO:0003707	IEA:InterPro	F	steroid hormone receptor activity
GO:0008270	IEA:InterPro	F	zinc ion binding
GO:0046618	ISS:UniProtKB	P	drug export
GO:0042738	ISS:UniProtKB	P	exogenous drug catabolic process
GO:0045892	IEA:Ensembl	P	negative regulation of transcription, DNA-templated
GO:0045893	ISS:UniProtKB	P	positive regulation of transcription, DNA-templated
GO:0006805	ISS:UniProtKB	P	xenobiotic metabolic process
GO:0042908	ISS:UniProtKB	P	xenobiotic transport

REACTOME Pathway Links

REACTOME Pathway ID	Description
5953330	Gene Expression
5953833	Generic Transcription Pathway
5954147	Nuclear Receptor transcription pathway

InterPro Annotations

Accession	Description
IPR008946	Nuclear hormone receptor, ligand-binding
IPR000536	Nuclear hormone receptor, ligand-binding, core
IPR001723	Steroid hormone receptor
IPR013088	Zinc finger, NHR/GATA-type
IPR001628	Zinc finger, nuclear hormone receptor-type

Entry Information

Gene Name

nuclear receptor subfamily 1, group I, member 2

Protein Entry

NR1I2_RAT

UniProt ID

Q9R1A7

Species

Rat

Comments

Comment Type	Description
Function	Nuclear receptor that binds and is activated by a variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, endogenous compounds and drugs. Response to specific ligands is species-specific, due to differences in the ligand- binding domain. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes (By similarity)
Similarity	Belongs to the nuclear hormone receptor family. NR1 subfamily
Similarity	Contains 1 nuclear receptor DNA-binding domain
Subcellular Location	Nucleus {ECO:0000255\|PROSITE- ProRule:PRU00407}.
Subunit	Heterodimer with RXRA. Interacts with NCOA1 (By similarity)

Unique RefSeq proteins for LMP012812 (as displayed in Record Overview)

Protein GI	Database	Accession	Length	Protein Name
16418481	RefSeq	NP_443212	431	nuclear receptor subfamily 1 group I member 2

Identical Sequences to LMP012812 proteins

Reference	Database	Accession	Length	Protein Name
GI:16418481	GenBank	AAD47214.1	431	pregnane X receptor [Rattus norvegicus]
GI:16418481	GenBank	EDM11231.1	431	nuclear receptor subfamily 1, group I, member 2 [Rattus norvegicus]
GI:16418481	SwissProt	Q9R1A7.1	431	RecName: Full=Nuclear receptor subfamily 1 group I member 2; AltName: Full=Orphan nuclear receptor PXR; AltName: Full=Pregnane X receptor [Rattus norvegicus]

Related Sequences to LMP012812 proteins

Reference	Database	Accession	Length	Protein Name
GI:16418481	GenBank	AAD47214.1	431	pregnane X receptor [Rattus norvegicus]
GI:16418481	GenBank	EDM11231.1	431	nuclear receptor subfamily 1, group I, member 2 [Rattus norvegicus]
GI:16418481	SwissProt	Q9R1A7.1	431	RecName: Full=Nuclear receptor subfamily 1 group I member 2; AltName: Full=Orphan nuclear receptor PXR; AltName: Full=Pregnane X receptor [Rattus norvegicus]