Gene/Proteome Database (LMPD)

LMPD ID
LMP012743
Gene ID
79131
Species
Rattus norvegicus (Rat)
Gene Name
fatty acid binding protein 3, muscle and heart
Gene Symbol
Fabp3
Alternate Names
fatty acid-binding protein, heart; H-FABP; fatty acid-binding protein 3; heart fatty acid binding protein; Fatty acid binding protein 3 heart; fatty acid binding protein 3 heart; heart-type fatty acid-binding protein;
Chromosome
5
Map Location
5q36
Summary
binds fatty acids; may play a role in fatty acid metabolism possibly including mitochondrial beta-oxidation of fatty acids [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Fabp3

Proteins

fatty acid-binding protein, heart
Refseq ID NP_077076
Protein GI 13162363
UniProt ID P07483
mRNA ID NM_024162
Length 133
MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTHSTFKNTEISFQLGVEFDEVTADDRKVKSVVTLDGGKLVHVQKWDGQETTLTRELSDGKLILTLTHGNVVSTRTYEKEA

Gene Information

Entrez Gene ID
79131
Gene Name
fatty acid binding protein 3, muscle and heart
Gene Symbol
Fabp3
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:RGD C cytoplasm
GO:0005829 IDA:RGD C cytosol
GO:0005615 IEA:Ensembl C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0016528 IDA:RGD C sarcoplasm
GO:0005504 IPI:RGD F fatty acid binding
GO:0050543 IPI:RGD F icosatetraenoic acid binding
GO:0005324 IPI:RGD F long-chain fatty acid transporter activity
GO:0070538 IEA:Ensembl F oleic acid binding
GO:0006635 NAS:RGD P fatty acid beta-oxidation
GO:0006631 IEP:RGD P fatty acid metabolic process
GO:0015909 IDA:RGD P long-chain fatty acid transport
GO:0042493 IEP:RGD P response to drug
GO:0070542 IEP:RGD P response to fatty acid
GO:0032868 IEP:RGD P response to insulin

KEGG Pathway Links

KEGG Pathway ID Description
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR000463 Cytosolic fatty-acid binding
IPR000566 Lipocalin/cytosolic fatty-acid binding domain

UniProt Annotations

Entry Information

Gene Name
fatty acid binding protein 3, muscle and heart
Protein Entry
FABPH_RAT
UniProt ID
P07483
Species
Rat

Comments

Comment Type Description
Domain Forms a beta-barrel structure that accommodates the hydrophobic ligand in its interior
Function FABP are thought to play a role in the intracellular transport of long-chain fatty acids and their acyl-CoA esters.
Mass Spectrometry Mass=14683.9; Mass_error=3; Method=Electrospray; Range=2-133; Evidence= ;
Similarity Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family
Subcellular Location Cytoplasm.
Tissue Specificity Heart, but also skeletal muscle, kidney, brain and mammary gland.

Identical and Related Proteins

Unique RefSeq proteins for LMP012743 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
13162363 RefSeq NP_077076 133 fatty acid-binding protein, heart

Identical Sequences to LMP012743 proteins

Reference Database Accession Length Protein Name
GI:13162363 GenBank AAA41136.1 133 fatty acid binding protein [Rattus norvegicus]
GI:13162363 GenBank AAA41137.1 133 fatty acid binding protein [Rattus norvegicus]
GI:13162363 GenBank EDL80590.1 133 fatty acid binding protein 3 [Rattus norvegicus]
GI:13162363 SwissProt P07483.2 133 RecName: Full=Fatty acid-binding protein, heart; AltName: Full=Fatty acid-binding protein 3; AltName: Full=Heart-type fatty acid-binding protein; Short=H-FABP [Rattus norvegicus]

Related Sequences to LMP012743 proteins

Reference Database Accession Length Protein Name
GI:13162363 GenBank AAA41136.1 133 fatty acid binding protein [Rattus norvegicus]
GI:13162363 GenBank AAA41137.1 133 fatty acid binding protein [Rattus norvegicus]
GI:13162363 SwissProt P07483.2 133 RecName: Full=Fatty acid-binding protein, heart; AltName: Full=Fatty acid-binding protein 3; AltName: Full=Heart-type fatty acid-binding protein; Short=H-FABP [Rattus norvegicus]