Gene/Proteome Database (LMPD)

LMPD ID
LMP012704
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Gene Symbol
Synonyms
Dcrakl; putativeperoxisomal24-dienoyl-CoAreductase;
Alternate Names
peroxisomal 2,4-dienoyl-CoA reductase; DCR-AKL; pVI-AKL; 2,4-dienoyl-CoA reductase 2; putative peroxisomal 24-dienoyl-CoA reductase; putative peroxisomal 2,4-dienoyl-CoA reductase; 2-4-dienoyl-Coenzyme A reductase 2, peroxisomal;
Chromosome
10
Map Location
10q12
EC Number
1.3.1.34
Summary
required for the degradation of unsaturated fatty acids [RGD, Feb 2006]
Orthologs

Proteins

peroxisomal 2,4-dienoyl-CoA reductase
Refseq ID NP_741993
Protein GI 25282441
UniProt ID Q9Z2M4
mRNA ID NM_171996
Length 292
MTQQPPDVEEDDCLSEYHHLFCPDLLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRVPPAVMAAVDQALKEFGKIDILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLGGPKASSKFKYLSSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTLPNDIGRLLEFESSSAKL

Gene Information

Entrez Gene ID
Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005778 IDA:UniProtKB C peroxisomal membrane
GO:0005777 IDA:HGNC C peroxisome
GO:0008670 IDA:UniProtKB F 2,4-dienoyl-CoA reductase (NADPH) activity
GO:0019166 IEA:Ensembl F trans-2-enoyl-CoA reductase (NADPH) activity
GO:0006636 IEA:Ensembl P unsaturated fatty acid biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
ko04146 Peroxisome
rno04146 Peroxisome

Domain Information

InterPro Annotations

Accession Description
IPR002347 Glucose/ribitol dehydrogenase
IPR016040 NAD(P)-binding domain
IPR002198 Short-chain dehydrogenase/reductase SDR

UniProt Annotations

Entry Information

Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Protein Entry
DECR2_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Trans-2,3-didehydroacyl-CoA + NADP(+) = trans,trans-2,3,4,5-tetradehydroacyl-CoA + NADPH
Function Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19- docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid.
Similarity Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily
Subcellular Location Peroxisome .
Subunit Monomer, dimer and oligomer

Identical and Related Proteins

Unique RefSeq proteins for LMP012704 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
25282441 RefSeq NP_741993 292 peroxisomal 2,4-dienoyl-CoA reductase

Identical Sequences to LMP012704 proteins

Reference Database Accession Length Protein Name
GI:25282441 GenBank AAH70959.1 292 2,4-dienoyl CoA reductase 2, peroxisomal [Rattus norvegicus]
GI:25282441 GenBank EDM03991.1 292 2-4-dienoyl-Coenzyme A reductase 2, peroxisomal [Rattus norvegicus]
GI:25282441 RefSeq XP_006246086.1 292 PREDICTED: peroxisomal 2,4-dienoyl-CoA reductase isoform X1 [Rattus norvegicus]
GI:25282441 SwissProt Q9Z2M4.1 292 RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase; AltName: Full=2,4-dienoyl-CoA reductase 2; AltName: Full=DCR-AKL; AltName: Full=pVI-AKL [Rattus norvegicus]

Related Sequences to LMP012704 proteins

Reference Database Accession Length Protein Name
GI:25282441 GenBank AAD02333.1 292 putative peroxisomal 2,4-dienoyl-CoA reductase [Rattus norvegicus]
GI:25282441 GenBank AAH70959.1 292 2,4-dienoyl CoA reductase 2, peroxisomal [Rattus norvegicus]
GI:25282441 SwissProt Q9Z2M4.1 292 RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase; AltName: Full=2,4-dienoyl-CoA reductase 2; AltName: Full=DCR-AKL; AltName: Full=pVI-AKL [Rattus norvegicus]