Gene/Proteome Database (LMPD)
LMPD ID
LMP012704
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Gene Symbol
Synonyms
Dcrakl; putativeperoxisomal24-dienoyl-CoAreductase;
Alternate Names
peroxisomal 2,4-dienoyl-CoA reductase; DCR-AKL; pVI-AKL; 2,4-dienoyl-CoA reductase 2; putative peroxisomal 24-dienoyl-CoA reductase; putative peroxisomal 2,4-dienoyl-CoA reductase; 2-4-dienoyl-Coenzyme A reductase 2, peroxisomal;
Chromosome
10
Map Location
10q12
EC Number
1.3.1.34
Summary
required for the degradation of unsaturated fatty acids [RGD, Feb 2006]
Orthologs
Proteins
| peroxisomal 2,4-dienoyl-CoA reductase | |
|---|---|
| Refseq ID | NP_741993 |
| Protein GI | 25282441 |
| UniProt ID | Q9Z2M4 |
| mRNA ID | NM_171996 |
| Length | 292 |
| MTQQPPDVEEDDCLSEYHHLFCPDLLQDKVAFITGGGSGIGFRIAEIFMRHGCHTVIVSRSLPRVSEAAKKLVAATGKRCLPLSMDVRVPPAVMAAVDQALKEFGKIDILINCAAGNFLCPASALSFNAFKTVVDIDTLGTFNVSRVLYEKFFRDHGGVIVNITATLSMRGQVLQLHAGAAKAAVDAMTRHLAVEWGPQNIRVNSLAPGAISGTEGLRRLGGPKASSKFKYLSSPIPRLGTKTEIAHSVLYLASPLASYVSGIVLVVDGGSWMTLPNDIGRLLEFESSSAKL | |
Gene Information
Entrez Gene ID
Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005778 | IDA:UniProtKB | C | peroxisomal membrane |
| GO:0005777 | IDA:HGNC | C | peroxisome |
| GO:0008670 | IDA:UniProtKB | F | 2,4-dienoyl-CoA reductase (NADPH) activity |
| GO:0019166 | IEA:Ensembl | F | trans-2-enoyl-CoA reductase (NADPH) activity |
| GO:0006636 | IEA:Ensembl | P | unsaturated fatty acid biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
2,4-dienoyl CoA reductase 2, peroxisomal
Protein Entry
DECR2_RAT
UniProt ID
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Trans-2,3-didehydroacyl-CoA + NADP(+) = trans,trans-2,3,4,5-tetradehydroacyl-CoA + NADPH |
| Function | Auxiliary enzyme of beta-oxidation. Participates in the degradation of unsaturated fatty enoyl-CoA esters having double bonds in both even- and odd-numbered positions in peroxisome. Catalyzes the NADP-dependent reduction of 2,4-dienoyl-CoA to yield trans-3-enoyl-CoA. Has activity towards short and medium chain 2,4-dienoyl-CoAs, but also towards 2,4,7,10,13,16,19- docosaheptaenoyl-CoA, suggesting that it does not constitute a rate limiting step in the peroxisomal degradation of docosahexaenoic acid. |
| Similarity | Belongs to the short-chain dehydrogenases/reductases (SDR) family. 2,4-dienoyl-CoA reductase subfamily |
| Subcellular Location | Peroxisome . |
| Subunit | Monomer, dimer and oligomer |
Identical and Related Proteins
Unique RefSeq proteins for LMP012704 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 25282441 | RefSeq | NP_741993 | 292 | peroxisomal 2,4-dienoyl-CoA reductase |
Identical Sequences to LMP012704 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:25282441 | GenBank | AAH70959.1 | 292 | 2,4-dienoyl CoA reductase 2, peroxisomal [Rattus norvegicus] |
| GI:25282441 | GenBank | EDM03991.1 | 292 | 2-4-dienoyl-Coenzyme A reductase 2, peroxisomal [Rattus norvegicus] |
| GI:25282441 | RefSeq | XP_006246086.1 | 292 | PREDICTED: peroxisomal 2,4-dienoyl-CoA reductase isoform X1 [Rattus norvegicus] |
| GI:25282441 | SwissProt | Q9Z2M4.1 | 292 | RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase; AltName: Full=2,4-dienoyl-CoA reductase 2; AltName: Full=DCR-AKL; AltName: Full=pVI-AKL [Rattus norvegicus] |
Related Sequences to LMP012704 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:25282441 | GenBank | AAD02333.1 | 292 | putative peroxisomal 2,4-dienoyl-CoA reductase [Rattus norvegicus] |
| GI:25282441 | GenBank | AAH70959.1 | 292 | 2,4-dienoyl CoA reductase 2, peroxisomal [Rattus norvegicus] |
| GI:25282441 | SwissProt | Q9Z2M4.1 | 292 | RecName: Full=Peroxisomal 2,4-dienoyl-CoA reductase; AltName: Full=2,4-dienoyl-CoA reductase 2; AltName: Full=DCR-AKL; AltName: Full=pVI-AKL [Rattus norvegicus] |