Gene/Proteome Database (LMPD)

LMPD ID
LMP012630
Gene ID
29733
Species
Rattus norvegicus (Rat)
Gene Name
sphingosine-1-phosphate receptor 1
Gene Symbol
S1pr1
Synonyms
Edg1;
Alternate Names
sphingosine 1-phosphate receptor 1; S1P1; EDG1 (Edg1); S1P receptor 1; S1P receptor Edg-1; sphingosine 1-phosphate receptor Edg-1; endothelial differentiation G-protein coupled receptor 1; endothelial differentiation sphingolipid G-protein-coupled receptor 1;
Chromosome
2
Map Location
2q41
Summary
G-protein-coupled receptor homolog; may mediate neurotransmission and endothelial cell differentiation [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for S1pr1

Proteins

sphingosine 1-phosphate receptor 1
Refseq ID NP_058997
Protein GI 8393290
UniProt ID P48303
mRNA ID NM_017301
Length 383
MVSSTSIPVVKALRSQVSDYGNYDIIVRHYNYTGKLNIGVEKDHGIKLTSVVFILICCLIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPIMGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIISCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSSHPQKDDGDNPETIMSSGNVNSSS

Gene Information

Entrez Gene ID
29733
Gene Name
sphingosine-1-phosphate receptor 1
Gene Symbol
S1pr1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005768 IEA:UniProtKB-KW C endosome
GO:0009897 IEA:Ensembl C external side of plasma membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0031226 ISS:UniProtKB C intrinsic component of plasma membrane
GO:0004930 IMP:RGD F G-protein coupled receptor activity
GO:0046625 IDA:RGD F sphingolipid binding
GO:0038036 ISS:UniProtKB F sphingosine-1-phosphate receptor activity
GO:0007186 IMP:RGD P G-protein coupled receptor signaling pathway
GO:0072678 ISS:UniProtKB P T cell migration
GO:0031532 ISS:UniProtKB P actin cytoskeleton reorganization
GO:0007193 IMP:RGD P adenylate cyclase-inhibiting G-protein coupled receptor signaling pathway
GO:0001525 IEA:UniProtKB-KW P angiogenesis
GO:0001955 ISS:UniProtKB P blood vessel maturation
GO:0007420 IEA:Ensembl P brain development
GO:0003245 ISS:UniProtKB P cardiac muscle tissue growth involved in heart morphogenesis
GO:0016477 ISS:UniProtKB P cell migration
GO:0006935 ISS:UniProtKB P chemotaxis
GO:0045446 IEP:RGD P endothelial cell differentiation
GO:0061384 ISS:UniProtKB P heart trabecula morphogenesis
GO:0030032 ISS:UniProtKB P lamellipodium assembly
GO:0051497 IDA:RGD P negative regulation of stress fiber assembly
GO:0030182 IEP:RGD P neuron differentiation
GO:0032320 IDA:RGD P positive regulation of Ras GTPase activity
GO:0030335 IDA:RGD P positive regulation of cell migration
GO:0051482 IMP:RGD P positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G-protein coupled signaling pathway
GO:0050927 IDA:RGD P positive regulation of positive chemotaxis
GO:0048661 IDA:RGD P positive regulation of smooth muscle cell proliferation
GO:0045944 IMP:RGD P positive regulation of transcription from RNA polymerase II promoter
GO:0030500 ISS:UniProtKB P regulation of bone mineralization
GO:0045124 ISS:UniProtKB P regulation of bone resorption
GO:0030155 IEA:Ensembl P regulation of cell adhesion
GO:0003376 ISS:UniProtKB P sphingosine-1-phosphate signaling pathway
GO:0019226 IEP:RGD P transmission of nerve impulse

KEGG Pathway Links

KEGG Pathway ID Description
rno04068 FoxO signaling pathway
ko04080 Neuroactive ligand-receptor interaction
rno04080 Neuroactive ligand-receptor interaction

REACTOME Pathway Links

REACTOME Pathway ID Description
5954122 Class A/1 (Rhodopsin-like receptors)
5954152 G alpha (i) signalling events
5953642 GPCR downstream signaling
5953758 GPCR ligand binding
5954244 Lysosphingolipid and LPA receptors
5953381 Signal Transduction
5953391 Signaling by GPCR

Domain Information

InterPro Annotations

Accession Description
IPR000987 EDG-1 sphingosine 1-phosphate receptor
IPR000276 G protein-coupled receptor, rhodopsin-like
IPR017452 GPCR, rhodopsin-like, 7TM
IPR004061 Sphingosine 1-phosphate receptor

UniProt Annotations

Entry Information

Gene Name
sphingosine-1-phosphate receptor 1
Protein Entry
S1PR1_RAT
UniProt ID
P48303
Species
Rat

Comments

Comment Type Description
Developmental Stage First detected at embryonic day 15. At postnatal day 14 detected in skin, spleen, liver, kidney, heart, testicle, lung and brain. At adulthood is most abundant in brain
Function G-protein coupled receptor for the bioactive lysosphingolipid sphingosine 1-phosphate (S1P) that seems to be coupled to the G(i) subclass of heteromeric G proteins. Signaling leads to the activation of RAC1, SRC, PTK2/FAK1 and MAP kinases. Plays an important role in cell migration, probably via its role in the reorganization of the actin cytoskeleton and the formation of lamellipodia in response to stimuli that increase the activity of the sphingosine kinase SPHK1. Required for normal chemotaxis toward sphingosine 1-phosphate. Required for normal embryonic heart development and normal cardiac morphogenesis. Plays an important role in the regulation of sprouting angiogenesis and vascular maturation. Inhibits sprouting angiogenesis to prevent excessive sprouting during blood vessel development. Required for normal egress of mature T-cells from the thymus into the blood stream and into peripheral lymphoid organs. Plays a role in the migration of osteoclast precursor cells, the regulation of bone mineralization and bone homeostasis. Plays a role in responses to oxidized 1-palmitoyl-2-arachidonoyl-sn-glycero-3-phosphocholine by pulmonary endothelial cells and in the protection against ventilator-induced lung injury (By similarity)
Similarity Belongs to the G-protein coupled receptor 1 family
Subcellular Location Cell membrane ; Multi-pass membrane protein {ECO:0000250}. Endosome . Membrane raft . Note=Recruited to caveolin-enriched plasma membrane microdomains in response to oxidized 1-palmitoyl-2- arachidonoyl-sn-glycero-3-phosphocholine. Ligand binding leads to receptor internalization (By similarity)
Subunit Interacts with GNAI1 and GNAI3

Identical and Related Proteins

Unique RefSeq proteins for LMP012630 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
8393290 RefSeq NP_058997 383 sphingosine 1-phosphate receptor 1

Identical Sequences to LMP012630 proteins

Reference Database Accession Length Protein Name
GI:8393290 GenBank AAP00842.1 383 Sequence 4 from patent US 6518414
GI:8393290 GenBank AAH97938.1 383 Sphingosine-1-phosphate receptor 1 [Rattus norvegicus]
GI:8393290 GenBank EDL82014.1 383 endothelial differentiation sphingolipid G-protein-coupled receptor 1 [Rattus norvegicus]
GI:8393290 RefSeq XP_008759681.1 383 PREDICTED: sphingosine 1-phosphate receptor 1 isoform X1 [Rattus norvegicus]

Related Sequences to LMP012630 proteins

Reference Database Accession Length Protein Name
GI:8393290 GenBank AAA83418.1 383 Edg-1 orphan receptor [Rattus norvegicus]
GI:8393290 GenBank EDL82014.1 383 endothelial differentiation sphingolipid G-protein-coupled receptor 1 [Rattus norvegicus]
GI:8393290 RefSeq XP_008759681.1 383 PREDICTED: sphingosine 1-phosphate receptor 1 isoform X1 [Rattus norvegicus]