Gene/Proteome Database (LMPD)

LMPD ID
LMP012599
Gene ID
29500
Species
Rattus norvegicus (Rat)
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 2
Gene Symbol
Slc10a2
Synonyms
ISBAT;
Alternate Names
ileal sodium/bile acid cotransporter; ASBT; IBAT; ISBT; solute carrier family 10 member 2; solute carrier family 10, member 2; ileal Na(+)/bile acid cotransporter; Na(+)-dependent ileal bile acid transporter; ileal sodium-dependent bile acid transporter; apical sodium-dependent bile acid transporter; sodium/taurocholate-cotransporting polypeptide, ileal; solute carrier family 10 (sodium/bile acid cotransporter family), member 2;
Chromosome
16
Map Location
16q12.5
Summary
mediates sodium-dependent transport of bile acids; plays a role in bile acid circulation and reabsorption; facilitates cholesterol catabolism [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Slc10a2

Proteins

ileal sodium/bile acid cotransporter
Refseq ID NP_058918
Protein GI 8394281
UniProt ID Q62633
mRNA ID NM_017222
Length 348
MDNSSVCSPNATFCEGDSCLVTESNFNAILSTVMSTVLTILLAMVMFSMGCNVEINKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFIYTKMWVDSGTIVIPYDSIGISLVALVIPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIEPKLWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVFAAIILGMYVTYKKCHGKNDAEFLEKTDNDMDPMPSFQETNKGFQPDEK

Gene Information

Entrez Gene ID
29500
Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 2
Gene Symbol
Slc10a2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016324 IDA:RGD C apical plasma membrane
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0005902 IEA:Ensembl C microvillus
GO:0005634 IDA:RGD C nucleus
GO:0000502 IDA:RGD C proteasome complex
GO:0008508 IDA:RGD F bile acid:sodium symporter activity
GO:0015721 IDA:RGD P bile acid and bile salt transport
GO:0008206 TAS:RGD P bile acid metabolic process
GO:0006814 TAS:RGD P sodium ion transport

KEGG Pathway Links

KEGG Pathway ID Description
ko04976 Bile secretion
rno04976 Bile secretion

REACTOME Pathway Links

REACTOME Pathway ID Description
5953720 Bile acid and bile salt metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953719 Recycling of bile acids and salts

Domain Information

InterPro Annotations

Accession Description
IPR004710 Bile acid:sodium symporter
IPR002657 Bile acid:sodium symporter/arsenical resistance protein Acr3

UniProt Annotations

Entry Information

Gene Name
solute carrier family 10 (sodium/bile acid cotransporter), member 2
Protein Entry
NTCP2_RAT
UniProt ID
Q62633
Species
Rat

Comments

Comment Type Description
Developmental Stage Transcriptionally regulated increases in mRNA and protein levels at the time of weaning.
Function Plays a critical role in the sodium-dependent reabsorption of bile acids from the lumen of the small intestine. Plays a key role in cholesterol metabolism (By similarity)
Similarity Belongs to the bile acid:sodium symporter (BASS) (TC 2.A.28) family
Subcellular Location Membrane; Multi-pass membrane protein.
Subunit Monomer and homodimer

Identical and Related Proteins

Unique RefSeq proteins for LMP012599 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
8394281 RefSeq NP_058918 348 ileal sodium/bile acid cotransporter

Identical Sequences to LMP012599 proteins

Reference Database Accession Length Protein Name
GI:8394281 GenBank AAC53101.1 348 ileal sodium-dependent bile acid transporter [Rattus norvegicus]
GI:8394281 PRF - 348 Na-dependent bile acid transporter [Rattus norvegicus]
GI:8394281 SwissProt Q62633.1 348 RecName: Full=Ileal sodium/bile acid cotransporter; AltName: Full=Apical sodium-dependent bile acid transporter; Short=ASBT; AltName: Full=Ileal Na(+)/bile acid cotransporter; AltName: Full=Ileal sodium-dependent bile acid transporter; Short=IBAT; Short=ISBT; AltName: Full=Na(+)-dependent ileal bile acid transporter; AltName: Full=Sodium/taurocholate-cotransporting polypeptide, ileal; AltName: Full=Solute carrier family 10 member 2 [Rattus norvegicus]

Related Sequences to LMP012599 proteins

Reference Database Accession Length Protein Name
GI:8394281 GenBank AAC53101.1 348 ileal sodium-dependent bile acid transporter [Rattus norvegicus]
GI:8394281 PRF - 348 Na-dependent bile acid transporter [Rattus norvegicus]
GI:8394281 SwissProt Q62633.1 348 RecName: Full=Ileal sodium/bile acid cotransporter; AltName: Full=Apical sodium-dependent bile acid transporter; Short=ASBT; AltName: Full=Ileal Na(+)/bile acid cotransporter; AltName: Full=Ileal sodium-dependent bile acid transporter; Short=IBAT; Short=ISBT; AltName: Full=Na(+)-dependent ileal bile acid transporter; AltName: Full=Sodium/taurocholate-cotransporting polypeptide, ileal; AltName: Full=Solute carrier family 10 member 2 [Rattus norvegicus]