Gene/Proteome Database (LMPD)
LMPD ID
LMP012572
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
squalene epoxidase
Gene Symbol
Alternate Names
squalene monooxygenase; SE;
Chromosome
7
Map Location
7q33
EC Number
1.14.13.132
Summary
enzyme that catalyzes sterol biosyntesis; may be the rare-limiting step in sterol biosynthesis pathway [RGD, Feb 2006]
Orthologs
Proteins
| squalene monooxygenase | |
|---|---|
| Refseq ID | NP_058832 |
| Protein GI | 8394354 |
| UniProt ID | P52020 |
| mRNA ID | NM_017136 |
| Length | 573 |
| MWTFLGIATFTYFYKKCGDVTLANKELLLCVLVFLSLGLVLSYRCRHRNGGLLGRHQSGSQFAAFSDILSALPLIGFFWAKSPPESEKKEQLESKRRRKEVNLSETTLTGAATSVSTSSVTDPEVIIIGSGVLGSALATVLSRDGRTVTVIERDLKEPDRILGECLQPGGYRVLRELGLGDTVESLNAHHIHGYVIHDCESRSEVQIPYPVSENNQVQSGVAFHHGKFIMSLRKAAMAEPNVKFIEGVVLRLLEEDDAVIGVQYKDKETGDTKELHAPLTVVADGLFSKFRKNLISNKVSVSSHFVGFIMKDAPQFKANFAELVLVDPSPVLIYQISPSETRVLVDIRGELPRNLREYMTEQIYPQIPDHLKESFLEACQNARLRTMPASFLPPSSVNKRGVLLLGDAYNLRHPLTGGGMTVALKDIKIWRQLLKDIPDLYDDAAIFQAKKSFFWSRKRSHSFVVNVLAQALYELFSATDDSLRQLRKACFLYFKLGGECLTGPVGLLSILSPDPLLLIRHFFSVAVYATYFCFKSEPWATKPRALFSSGAILYKACSIIFPLIYSEMKYLVH | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005783 | IEA:UniProtKB-KW | C | endoplasmic reticulum |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0043231 | IDA:RGD | C | intracellular membrane-bounded organelle |
| GO:0050660 | IEA:InterPro | F | flavin adenine dinucleotide binding |
| GO:0004506 | IDA:RGD | F | squalene monooxygenase activity |
| GO:0006725 | IDA:RGD | P | cellular aromatic compound metabolic process |
| GO:0008203 | IMP:RGD | P | cholesterol metabolic process |
| GO:0010033 | IDA:RGD | P | response to organic substance |
KEGG Pathway Links
| KEGG Pathway ID | Description |
|---|---|
| rno01100 | Metabolic pathways |
| ko00100 | Steroid biosynthesis |
| rno00100 | Steroid biosynthesis |
REACTOME Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Squalene + NADPH + O(2) = (3S)-2,3-epoxy-2,3- dihydrosqualene + NADP(+) + H(2)O. |
| Cofactor | Name=FAD; Xref=ChEBI:CHEBI:57692; |
| Function | Catalyzes the first oxygenation step in sterol biosynthesis and is suggested to be one of the rate-limiting enzymes in this pathway. |
| Pathway | Terpene metabolism; lanosterol biosynthesis; lanosterol from farnesyl diphosphate: step 2/3. |
| Similarity | Belongs to the squalene monooxygenase family |
| Subcellular Location | Microsome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. |
| Subunit | May form a complex with squalene synthase. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012572 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 8394354 | RefSeq | NP_058832 | 573 | squalene monooxygenase |
Identical Sequences to LMP012572 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:8394354 | GenBank | AAE03454.1 | 573 | Sequence 4 from patent US 5861496 |
| GI:8394354 | GenBank | AAE55206.1 | 573 | Sequence 7 from patent US 6153815 |
| GI:8394354 | GenBank | AAH97330.1 | 573 | Sqle protein [Rattus norvegicus] |
| GI:8394354 | GenBank | EDM16202.1 | 573 | squalene epoxidase [Rattus norvegicus] |
Related Sequences to LMP012572 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:8394354 | DBBJ | BAA07141.1 | 573 | squalene epoxidase [Rattus norvegicus] |
| GI:8394354 | GenBank | AAE55206.1 | 573 | Sequence 7 from patent US 6153815 |
| GI:8394354 | GenBank | EDM16202.1 | 573 | squalene epoxidase [Rattus norvegicus] |