Gene/Proteome Database (LMPD)

LMPD ID
LMP012569
Gene ID
29221
Species
Rattus norvegicus (Rat)
Gene Name
arginase 1
Gene Symbol
Arg1
Alternate Names
arginase-1; arginase, liver; type I arginase; AI type I arginase; liver-type arginase;
Chromosome
1
Map Location
1p12
EC Number
3.5.3.1
Summary
catalyzes the hydrolysis of arginine to ornithine and urea in arginine metabolism; regulates nitric oxide production [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Arg1

Proteins

arginase-1
Refseq ID NP_058830
Protein GI 166091458
UniProt ID P07824
mRNA ID NM_017134
Length 323
MSSKPKPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPNDSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVFTPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALTLSCFGTKREGNHKPETDYLKPPK

Gene Information

Entrez Gene ID
29221
Gene Name
arginase 1
Gene Symbol
Arg1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:RGD C cytoplasm
GO:0005615 IDA:RGD C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005741 IDA:RGD C mitochondrial outer membrane
GO:0043005 IDA:RGD C neuron projection
GO:0043025 IDA:RGD C neuronal cell body
GO:0005634 IEA:Ensembl C nucleus
GO:0004053 IDA:RGD F arginase activity
GO:0030145 IDA:RGD F manganese ion binding
GO:0007568 IEP:RGD P aging
GO:0019547 IDA:RGD P arginine catabolic process to ornithine
GO:0006525 IDA:RGD P arginine metabolic process
GO:0071549 IEP:RGD P cellular response to dexamethasone stimulus
GO:0071377 IEP:RGD P cellular response to glucagon stimulus
GO:0070301 IEP:RGD P cellular response to hydrogen peroxide
GO:0071353 IEP:RGD P cellular response to interleukin-4
GO:0071222 IEP:RGD P cellular response to lipopolysaccharide
GO:0071560 IEP:RGD P cellular response to transforming growth factor beta stimulus
GO:0032964 IMP:RGD P collagen biosynthetic process
GO:0007565 IEP:RGD P female pregnancy
GO:0001889 IEP:RGD P liver development
GO:0030324 IEP:RGD P lung development
GO:0060056 IEP:RGD P mammary gland involution
GO:0060135 IEP:RGD P maternal process involved in female pregnancy
GO:0001938 IDA:RGD P positive regulation of endothelial cell proliferation
GO:0070207 IDA:RGD P protein homotrimerization
GO:0010963 IDA:RGD P regulation of L-arginine import
GO:0014075 IEP:RGD P response to amine
GO:0043200 IEP:RGD P response to amino acid
GO:0048678 IEP:RGD P response to axon injury
GO:0046686 IEP:RGD P response to cadmium ion
GO:0042493 IEP:RGD P response to drug
GO:0009635 IEP:RGD P response to herbicide
GO:0032496 IEP:RGD P response to lipopolysaccharide
GO:0010042 IEP:RGD P response to manganese ion
GO:0051597 IEP:RGD P response to methylmercury
GO:0043434 IEP:RGD P response to peptide hormone
GO:0010269 IEP:RGD P response to selenium ion
GO:0048545 IEP:RGD P response to steroid hormone
GO:0033189 IEP:RGD P response to vitamin A
GO:0033197 IEP:RGD P response to vitamin E
GO:0009611 IEP:RGD P response to wounding
GO:0010043 IEP:RGD P response to zinc ion
GO:0000050 IDA:RGD P urea cycle

KEGG Pathway Links

KEGG Pathway ID Description
ko05146 Amoebiasis
rno05146 Amoebiasis
ko00330 Arginine and proline metabolism
rno00330 Arginine and proline metabolism
ko01230 Biosynthesis of amino acids
rno01230 Biosynthesis of amino acids
rno01100 Metabolic pathways
M00134 Polyamine biosynthesis, arginine => ornithine => putrescine
M00029 Urea cycle

REACTOME Pathway Links

REACTOME Pathway ID Description
5953250 Metabolism
5953272 Metabolism of amino acids and derivatives
5953273 Urea cycle

Domain Information

InterPro Annotations

Accession Description
IPR014033 Arginase
IPR006035 Ureohydrolase
IPR020855 Ureohydrolase_Mn_BS
IPR023696 Ureohydrolase_domain

UniProt Annotations

Entry Information

Gene Name
arginase 1
Protein Entry
ARGI1_RAT
UniProt ID
P07824
Species
Rat

Comments

Comment Type Description
Biophysicochemical Properties Kinetic parameters: KM=1.4 mM for arginine {ECO:0000269|PubMed:12820884, ECO:0000269|PubMed:16266687};
Catalytic Activity L-arginine + H(2)O = L-ornithine + urea.
Cofactor Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000255|PROSITE-ProRule:PRU00742, ECO:0000269|PubMed:12820884, ECO:0000269|PubMed:16266687}; Note=Binds 2 manganese ions per subunit. {ECO:0000255|PROSITE- ProRule:PRU00742, ECO:0000269|PubMed:12820884, ECO:0000269|PubMed:16266687};
Enzyme Regulation Inactivated by diethyl pyrocarbonate (DEPC).
Induction By arginine or homoarginine.
Pathway Nitrogen metabolism; urea cycle; L-ornithine and urea from L-arginine: step 1/1.
Similarity Belongs to the arginase family. {ECO:0000255|PROSITE- ProRule:PRU00742}.
Subcellular Location Cytoplasm.
Subunit Homotrimer. {ECO:0000269|PubMed:15315440, ECO:0000269|PubMed:16266687}.
Tissue Specificity Detected in liver (at protein level)

Identical and Related Proteins

Unique RefSeq proteins for LMP012569 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
166091458 RefSeq NP_058830 323 arginase-1

Identical Sequences to LMP012569 proteins

Reference Database Accession Length Protein Name
GI:166091458 GenBank AAH91158.1 323 Arginase, liver [Rattus norvegicus]
GI:166091458 PDB 1R1O 323 Chain A, Amino Acid Sulfonamides As Transition-State Analogue Inhibitors Of Arginase
GI:166091458 PDB 1R1O 323 Chain B, Amino Acid Sulfonamides As Transition-State Analogue Inhibitors Of Arginase
GI:166091458 PDB 1R1O 323 Chain C, Amino Acid Sulfonamides As Transition-State Analogue Inhibitors Of Arginase

Related Sequences to LMP012569 proteins

Reference Database Accession Length Protein Name
GI:166091458 PDB 1HQ5 323 Chain A, Crystal Structure Of The Binuclear Manganese Metalloenzyme Arginase Complexed With S-(2-Boronoethyl)-L-Cysteine, An L-Arginine Analogue
GI:166091458 PDB 1R1O 323 Chain B, Amino Acid Sulfonamides As Transition-State Analogue Inhibitors Of Arginase
GI:166091458 PDB 1R1O 323 Chain C, Amino Acid Sulfonamides As Transition-State Analogue Inhibitors Of Arginase