Gene/Proteome Database (LMPD)

LMPD ID
LMP012561
Gene ID
26200
Species
Rattus norvegicus (Rat)
Gene Name
['NADH dehydrogenase subunit 4L']
Gene Symbol
ND4L
Alternate Names
NADH dehydrogenase subunit 4L;
EC Number
1.6.5.3

Proteins

NADH dehydrogenase subunit 4L [Rattus norvegicus]
Refseq ID YP_665637
Protein GI 110189723
UniProt ID Q7H113
Length 98
MTSAFLNLTMAFTLSLLGTFMFRSHLMSTLLCLEGMMLSLFVMTSTSTLNSNSMISMTIPITILVFAACEAAVGLALLVKISNTYGTDYVQNLNLLQC

Gene Information

Entrez Gene ID
26200
Gene Name
['NADH dehydrogenase subunit 4L']
Gene Symbol
ND4L
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0008137 IEA:UniProtKB-EC F NADH dehydrogenase (ubiquinone) activity
GO:0042773 IEA:InterPro P ATP synthesis coupled electron transport

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
M00142 NADH:ubiquinone oxidoreductase, mitochondria
ko00190 Oxidative phosphorylation
rno00190 Oxidative phosphorylation
rno05012 Parkinson's disease

REACTOME Pathway Links

REACTOME Pathway ID Description
5953250 Metabolism
5953747 Respiratory electron transport
5953748 Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins.
5953270 The citric acid (TCA) cycle and respiratory electron transport

Domain Information

InterPro Annotations

Accession Description
IPR001133 NADH-ubiquinone oxidoreductase chain 4L/K

UniProt Annotations

Entry Information

Gene Name
['NADH dehydrogenase subunit 4L']
Protein Entry
Q7H113_RAT
UniProt ID
Q7H113
Species
Rat

Comments

Comment Type Description
Catalytic Activity NADH + ubiquinone + 5 H(+)(In) = NAD(+) + ubiquinol + 4 H(+)(Out)
Function Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone
Similarity Belongs to the complex I subunit 4L family

Identical and Related Proteins

Unique RefSeq proteins for LMP012561 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
110189723 RefSeq YP_665637 98 NADH dehydrogenase subunit 4L [Rattus norvegicus]

Identical Sequences to LMP012561 proteins

Reference Database Accession Length Protein Name
GI:110189723 GenBank AIU45700.1 98 NADH dehydrogenase subunit 4L (mitochondrion) [Rattus norvegicus]
GI:110189723 GenBank AIU45713.1 98 NADH dehydrogenase subunit 4L (mitochondrion) [Rattus norvegicus]
GI:110189723 GenBank AIY51550.1 98 NADH dehydrogenase subunit 4L (mitochondrion) [Rattus norvegicus]
GI:110189723 GenBank AIY51537.1 98 NADH dehydrogenase subunit 4L (mitochondrion) [Rattus norvegicus]

Related Sequences to LMP012561 proteins

Reference Database Accession Length Protein Name
GI:110189723 EMBL CAA32962.1 98 NADH subunit 4L (mitochondrion) [Rattus norvegicus]
GI:110189723 GenBank AFN06286.1 98 NADH dehydrogenase subunit 4L (mitochondrion) [Rattus norvegicus]
GI:110189723 GenBank AGS12829.1 98 NADH dehydrogenase subunit 4L (mitochondrion) [Rattus norvegicus]