Gene/Proteome Database (LMPD)

LMPD ID
LMP012550
Gene ID
25703
Species
Rattus norvegicus (Rat)
Gene Name
retinol binding protein 4, plasma
Gene Symbol
Rbp4
Synonyms
RBPA;
Alternate Names
retinol-binding protein 4; RBP; PRBP; plasma retinol-binding protein;
Chromosome
1
Map Location
1q53
Summary
may play a role in vitamin A transport [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Rbp4

Proteins

retinol-binding protein 4 precursor
Refseq ID NP_037294
Protein GI 158187535
UniProt ID P04916
mRNA ID NM_013162
Length 201
MEWVWALVLLAALGGGSAERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLTPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL
sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1844 peptide sequence: MEWVWALVLLAALGGGSA mat_peptide: 19..201 product: Retinol-binding protein 4 experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (P04916.1) calculated_mol_wt: 21394 peptide sequence: ERDCRVSSFRVKENFDKARFSGLWYAIAKKDPEGLFLQDNIIAEFSVDEKGHMSATAKGRVRLLSNWEVCADMVGTFTDTEDPAKFKMKYWGVASFLQRGNDDHWIIDTDYDTFALQYSCRLQNLDGTCADSYSFVFSRDPNGLTPETRRLVRQRQEELCLERQYRWIEHNGYCQSRPSRNSL

Gene Information

Entrez Gene ID
25703
Gene Name
retinol binding protein 4, plasma
Gene Symbol
Rbp4
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005615 IDA:RGD C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0043234 IDA:RGD C protein complex
GO:0046982 IDA:RGD F protein heterodimerization activity
GO:0016918 IEA:UniProtKB-KW F retinal binding
GO:0019841 IDA:RGD F retinol binding
GO:0034632 IDA:RGD F retinol transporter activity
GO:0005215 TAS:RGD F transporter activity
GO:0048738 IEA:Ensembl P cardiac muscle tissue development
GO:0050908 IEA:Ensembl P detection of light stimulus involved in visual perception
GO:0048562 IEA:Ensembl P embryonic organ morphogenesis
GO:0060059 IEA:Ensembl P embryonic retina morphogenesis in camera-type eye
GO:0048706 IEA:Ensembl P embryonic skeletal system development
GO:0048807 IEA:Ensembl P female genitalia morphogenesis
GO:0006094 IEA:Ensembl P gluconeogenesis
GO:0042593 IEA:Ensembl P glucose homeostasis
GO:0060347 IEA:Ensembl P heart trabecula formation
GO:0030324 IEA:Ensembl P lung development
GO:0030277 IEA:Ensembl P maintenance of gastrointestinal epithelium
GO:0008584 IEA:Ensembl P male gonad development
GO:0060044 IEA:Ensembl P negative regulation of cardiac muscle cell proliferation
GO:0051024 IEA:Ensembl P positive regulation of immunoglobulin secretion
GO:0032024 IEA:Ensembl P positive regulation of insulin secretion
GO:0045471 IEP:RGD P response to ethanol
GO:0032868 IEA:Ensembl P response to insulin
GO:0032526 IEA:Ensembl P response to retinoic acid
GO:0042574 IEA:Ensembl P retinal metabolic process
GO:0042572 IDA:RGD P retinol metabolic process
GO:0034633 IDA:RGD P retinol transport
GO:0007283 IEA:Ensembl P spermatogenesis
GO:0006810 TAS:RGD P transport
GO:0060157 IEA:Ensembl P urinary bladder development
GO:0060065 IEA:Ensembl P uterus development
GO:0060068 IEA:Ensembl P vagina development

REACTOME Pathway Links

REACTOME Pathway ID Description
5953253 Disease
5953382 Diseases associated with visual transduction
5954579 Retinoid cycle disease events
5954392 Retinoid metabolism and transport
5953381 Signal Transduction
5953384 The canonical retinoid cycle in rods (twilight vision)
5953380 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR012674 Calycin
IPR011038 Calycin-like
IPR002345 Lipocalin
IPR022272 Lipocalin family conserved site
IPR022271 Lipocalin, ApoD type
IPR000566 Lipocalin/cytosolic fatty-acid binding domain
IPR002449 Retinol binding protein/Purpurin

UniProt Annotations

Entry Information

Gene Name
retinol binding protein 4, plasma
Protein Entry
RET4_RAT
UniProt ID
P04916
Species
Rat

Comments

Comment Type Description
Function Delivers retinol from the liver stores to the peripheral tissues. In plasma, the RBP-retinol complex interacts with transthyretin, this prevents its loss by filtration through the kidney glomeruli.
Similarity Belongs to the calycin superfamily. Lipocalin family
Subcellular Location Secreted.

Identical and Related Proteins

Unique RefSeq proteins for LMP012550 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
158187535 RefSeq NP_037294 201 retinol-binding protein 4 precursor

Identical Sequences to LMP012550 proteins

Reference Database Accession Length Protein Name
GI:158187535 GenBank AAA42018.1 201 retinol-binding protein [Rattus norvegicus]
GI:158187535 GenBank EDM13210.1 201 retinol binding protein 4, plasma, isoform CRA_a [Rattus norvegicus]
GI:158187535 GenBank AAI67099.1 201 Retinol binding protein 4, plasma [Rattus norvegicus]
GI:158187535 SwissProt P04916.1 201 RecName: Full=Retinol-binding protein 4; AltName: Full=Plasma retinol-binding protein; Short=PRBP; Short=RBP; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012550 proteins

Reference Database Accession Length Protein Name
GI:158187535 GenBank AAA42018.1 201 retinol-binding protein [Rattus norvegicus]
GI:158187535 GenBank EDM13210.1 201 retinol binding protein 4, plasma, isoform CRA_a [Rattus norvegicus]
GI:158187535 SwissProt P04916.1 201 RecName: Full=Retinol-binding protein 4; AltName: Full=Plasma retinol-binding protein; Short=PRBP; Short=RBP; Flags: Precursor [Rattus norvegicus]