Gene/Proteome Database (LMPD)

LMPD ID
LMP012535
Gene ID
25608
Species
Rattus norvegicus (Rat)
Gene Name
leptin
Gene Symbol
Lep
Synonyms
OB; obese;
Alternate Names
leptin; obesity factor;
Chromosome
4
Map Location
4q22
Summary
involved in regulation of body weight, and may have a role in angiogenesis [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Lep

Proteins

leptin precursor
Refseq ID NP_037208
Protein GI 6981148
UniProt ID P50596
mRNA ID NM_013076
Length 167
MCWRPLCRFLWLWSYLSYVQAVPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC
sig_peptide: 1..21 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 2722 peptide sequence: MCWRPLCRFLWLWSYLSYVQA mat_peptide: 22..167 product: leptin calculated_mol_wt: 16162 peptide sequence: VPIHKVQDDTKTLIKTIVTRINDISHTQSVSARQRVTGLDFIPGLHPILSLSKMDQTLAVYQQILTSLPSQNVLQIAHDLENLRDLLHLLAFSKSCSLPQTRGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDLSPEC

Gene Information

Entrez Gene ID
25608
Gene Name
leptin
Gene Symbol
Lep
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:Ensembl C cytoplasm
GO:0005615 IDA:HGNC C extracellular space
GO:0005125 TAS:RGD F cytokine activity
GO:0005179 IDA:RGD F hormone activity
GO:0051428 IDA:RGD F peptide hormone receptor binding
GO:0007259 TAS:RGD P JAK-STAT cascade
GO:0060612 IEA:Ensembl P adipose tissue development
GO:0008343 ISS:HGNC P adult feeding behavior
GO:0008206 IEA:Ensembl P bile acid metabolic process
GO:0035630 IDA:RGD P bone mineralization involved in bone maturation
GO:0019933 TAS:RGD P cAMP-mediated signaling
GO:0003300 IDA:RGD P cardiac muscle hypertrophy
GO:0071298 IEP:RGD P cellular response to L-ascorbic acid
GO:0071300 IEP:RGD P cellular response to retinoic acid
GO:0021954 IEA:Ensembl P central nervous system neuron development
GO:0008203 IEA:Ensembl P cholesterol metabolic process
GO:0007623 IEP:RGD P circadian rhythm
GO:0042755 IEA:Ensembl P eating behavior
GO:0006112 IDA:RGD P energy reserve metabolic process
GO:0006635 IEA:Ensembl P fatty acid beta-oxidation
GO:0009062 IDA:RGD P fatty acid catabolic process
GO:0007565 IEP:RGD P female pregnancy
GO:0042593 IEA:Ensembl P glucose homeostasis
GO:0006006 IEA:Ensembl P glucose metabolic process
GO:0006114 IDA:RGD P glycerol biosynthetic process
GO:0042445 IEA:Ensembl P hormone metabolic process
GO:0030073 IEA:Ensembl P insulin secretion
GO:0035556 IDA:RGD P intracellular signal transduction
GO:0033210 IDA:RGD P leptin-mediated signaling pathway
GO:0050901 IDA:RGD P leukocyte tethering or rolling
GO:0043066 IDA:RGD P negative regulation of apoptotic process
GO:0032099 ISS:HGNC P negative regulation of appetite
GO:0061037 IDA:RGD P negative regulation of cartilage development
GO:0070093 IEA:Ensembl P negative regulation of glucagon secretion
GO:2000486 IMP:RGD P negative regulation of glutamine transport
GO:0009892 IDA:RGD P negative regulation of metabolic process
GO:0000122 IEA:Ensembl P negative regulation of transcription from RNA polymerase II promoter
GO:0045906 IDA:RGD P negative regulation of vasoconstriction
GO:0001542 IDA:RGD P ovulation from ovarian follicle
GO:0001890 IEA:Ensembl P placenta development
GO:0046427 IMP:RGD P positive regulation of JAK-STAT cascade
GO:0043410 IDA:RGD P positive regulation of MAPK cascade
GO:2000366 IEA:Ensembl P positive regulation of STAT protein import into nucleus
GO:0008284 IDA:RGD P positive regulation of cell proliferation
GO:0001819 IEP:RGD P positive regulation of cytokine production
GO:0048639 IEA:Ensembl P positive regulation of developmental growth
GO:0046881 IEP:RGD P positive regulation of follicle-stimulating hormone secretion
GO:2000491 IDA:RGD P positive regulation of hepatic stellate cell activation
GO:0046628 IDA:RGD P positive regulation of insulin receptor signaling pathway
GO:0043270 IDA:RGD P positive regulation of ion transport
GO:0033686 IEP:RGD P positive regulation of luteinizing hormone secretion
GO:0045639 IEA:Ensembl P positive regulation of myeloid cell differentiation
GO:0035360 IDA:RGD P positive regulation of peroxisome proliferator activated receptor signaling pathway
GO:2000379 IDA:RGD P positive regulation of reactive oxygen species metabolic process
GO:0042517 IMP:RGD P positive regulation of tyrosine phosphorylation of Stat3 protein
GO:0008217 IDA:RGD P regulation of blood pressure
GO:0045598 IEA:Ensembl P regulation of fat cell differentiation
GO:0006111 IEA:Ensembl P regulation of gluconeogenesis
GO:0050796 IEA:Ensembl P regulation of insulin secretion
GO:0030300 IEA:Ensembl P regulation of intestinal cholesterol absorption
GO:0060587 IDA:RGD P regulation of lipoprotein lipid oxidation
GO:0050810 IEA:Ensembl P regulation of steroid biosynthetic process
GO:0002021 IMP:RGD P response to dietary excess
GO:0001666 IEP:RGD P response to hypoxia
GO:0032868 IEA:Ensembl P response to insulin
GO:0007584 IEP:RGD P response to nutrient
GO:0033197 IEP:RGD P response to vitamin E
GO:0007260 IEA:Ensembl P tyrosine phosphorylation of STAT protein

KEGG Pathway Links

KEGG Pathway ID Description
ko04152 AMPK signaling pathway
rno04152 AMPK signaling pathway
ko04920 Adipocytokine signaling pathway
rno04920 Adipocytokine signaling pathway
ko04060 Cytokine-cytokine receptor interaction
rno04060 Cytokine-cytokine receptor interaction
ko04630 Jak-STAT signaling pathway
rno04630 Jak-STAT signaling pathway
ko04080 Neuroactive ligand-receptor interaction
rno04080 Neuroactive ligand-receptor interaction
ko04932 Non-alcoholic fatty liver disease (NAFLD)
rno04932 Non-alcoholic fatty liver disease (NAFLD)

REACTOME Pathway Links

REACTOME Pathway ID Description
5953533 Developmental Biology
5954171 Incretin synthesis, secretion, and inactivation
5953345 Metabolism of proteins
5954094 Peptide hormone metabolism
5953381 Signal Transduction
5953543 Signaling by Leptin
5954252 Synthesis, secretion, and deacylation of Ghrelin
5954170 Synthesis, secretion, and inactivation of Glucagon-like Peptide-1 (GLP-1)
5954166 Transcriptional regulation of white adipocyte differentiation

Domain Information

InterPro Annotations

Accession Description
IPR012351 Four-helical cytokine, core
IPR009079 Four-helical cytokine-like, core
IPR000065 Leptin

UniProt Annotations

Entry Information

Gene Name
leptin
Protein Entry
LEP_RAT
UniProt ID
P50596
Species
Rat

Comments

Comment Type Description
Function May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of Lep may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Similarity Belongs to the leptin family
Subcellular Location Secreted .

Identical and Related Proteins

Unique RefSeq proteins for LMP012535 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6981148 RefSeq NP_037208 167 leptin precursor

Identical Sequences to LMP012535 proteins

Reference Database Accession Length Protein Name
GI:6981148 GenBank EDM15203.1 167 leptin, isoform CRA_a [Rattus norvegicus]
GI:6981148 GenBank ABW45267.1 167 Sequence 4 from patent US 7261881
GI:6981148 GenBank ACM96538.1 167 Sequence 38 from patent US 7470669
GI:6981148 RefSeq XP_008760984.1 167 PREDICTED: leptin isoform X1 [Rattus norvegicus]

Related Sequences to LMP012535 proteins

Reference Database Accession Length Protein Name
GI:6981148 DBBJ BAA08529.1 167 leptin (ob product) [Rattus norvegicus]
GI:6981148 DBBJ BAA08296.1 167 rat ob [Rattus sp.]
GI:6981148 SwissProt P50596.1 167 RecName: Full=Leptin; AltName: Full=Obesity factor; Flags: Precursor [Rattus norvegicus]