Gene/Proteome Database (LMPD)

LMPD ID
LMP012530
Gene ID
25576
Species
Rattus norvegicus (Rat)
Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta
Gene Symbol
Ywhah
Synonyms
14-3-3e;
Alternate Names
14-3-3 protein eta; 14-3-3 protein eta-subtype; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide;
Chromosome
14
Map Location
14q21
Summary
belongs to the 14-3-3 family of proteins; mediates signal transduction via activation of protein kinase C and calcium/calmodulin-dependent protein kinase II [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Ywhah

Proteins

14-3-3 protein eta
Refseq ID NP_037184
Protein GI 6981710
UniProt ID P68511
mRNA ID NM_013052
Length 246
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLALLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

Gene Information

Entrez Gene ID
25576
Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta
Gene Symbol
Ywhah
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005886 IEA:Ensembl C plasma membrane
GO:0017080 ISS:BHF-UCL F sodium channel regulator activity
GO:0006713 IEA:Ensembl P glucocorticoid catabolic process
GO:0042921 IEA:Ensembl P glucocorticoid receptor signaling pathway
GO:0006886 IEA:Ensembl P intracellular protein transport
GO:0086010 ISS:BHF-UCL P membrane depolarization during action potential
GO:0050774 IEA:Ensembl P negative regulation of dendrite morphogenesis
GO:0045893 IEA:Ensembl P positive regulation of transcription, DNA-templated
GO:2000649 ISS:BHF-UCL P regulation of sodium ion transmembrane transporter activity
GO:0002028 ISS:BHF-UCL P regulation of sodium ion transport
GO:0021762 IEA:Ensembl P substantia nigra development

KEGG Pathway Links

KEGG Pathway ID Description
ko04110 Cell cycle
rno04110 Cell cycle
ko05169 Epstein-Barr virus infection
rno05169 Epstein-Barr virus infection
ko04390 Hippo signaling pathway
rno04390 Hippo signaling pathway
ko04114 Oocyte meiosis
rno04114 Oocyte meiosis
ko04151 PI3K-Akt signaling pathway
rno04151 PI3K-Akt signaling pathway
ko05203 Viral carcinogenesis
rno05203 Viral carcinogenesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953660 Activation of BAD and translocation to mitochondria
5953661 Activation of BH3-only proteins
5953314 Apoptosis
5953632 Intrinsic Pathway for Apoptosis
5953916 Membrane Trafficking
5954455 Translocation of GLUT4 to the plasma membrane

Domain Information

InterPro Annotations

Accession Description
IPR000308 14-3-3 protein
IPR023409 14-3-3 protein, conserved site
IPR023410 14-3-3_domain

UniProt Annotations

Entry Information

Gene Name
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta
Protein Entry
1433F_RAT
UniProt ID
P68511
Species
Rat

Comments

Comment Type Description
Function Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1 (By similarity)
Interaction Q3MUI1:Numb; NbExp=3; IntAct=EBI-444647, EBI-7007865;
Ptm Phosphorylated on Ser-59 by protein kinase C delta type catalytic subunit in a sphingosine-dependent fashion
Similarity Belongs to the 14-3-3 family
Subcellular Location Cytoplasm.
Subunit Homodimer (By similarity). Interacts with many nuclear hormone receptors and cofactors including AR, ESR1, ESR2, MC2R, NR3C1, NRIP1, PPARBP and THRA. Interacts with ABL1 (phosphorylated form); the interaction retains it in the cytoplasm. Weakly interacts with CDKN1B. Interacts with ARHGEF28 and CDK16. Interacts with GAB2 (By similarity). Interacts with KCNK18 in a phosphorylation-dependent manner. Interacts with SAMSN1 (By similarity). Interacts with the 'Ser-241' phosphorylated form of PDPK1 (By similarity)

Identical and Related Proteins

Unique RefSeq proteins for LMP012530 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6981710 RefSeq NP_037184 246 14-3-3 protein eta

Identical Sequences to LMP012530 proteins

Reference Database Accession Length Protein Name
GI:6981710 RefSeq XP_007952144.1 246 PREDICTED: 14-3-3 protein eta [Orycteropus afer afer]
GI:6981710 RefSeq XP_008564636.1 246 PREDICTED: 14-3-3 protein eta isoform X1 [Galeopterus variegatus]
GI:6981710 RefSeq XP_008564637.1 246 PREDICTED: 14-3-3 protein eta isoform X2 [Galeopterus variegatus]
GI:6981710 RefSeq XP_008839214.1 246 PREDICTED: 14-3-3 protein eta [Nannospalax galili]

Related Sequences to LMP012530 proteins

Reference Database Accession Length Protein Name
GI:6981710 GenBank AAH08187.1 246 Tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide [Mus musculus]
GI:6981710 GenBank JAA45930.1 246 Putative multifunctional chaperone 14-3-3 family [Desmodus rotundus]
GI:6981710 RefSeq XP_006747755.1 246 PREDICTED: 14-3-3 protein eta [Leptonychotes weddellii]