Gene/Proteome Database (LMPD)

LMPD ID
LMP012529
Gene ID
25575
Species
Rattus norvegicus (Rat)
Gene Name
secretoglobin, family 1A, member 1 (uteroglobin)
Gene Symbol
Scgb1a1
Synonyms
Ugb; CC10; CCSP; PCBB;
Alternate Names
uteroglobin; CCPBP; PCB-binding protein; secretoglobin family 1A member 1; clara cells 10 kDa secretory protein; clara cell phospholipid-binding protein; Uteroglobin (Clara cell secretory protein);
Chromosome
1
Map Location
1q43
Summary
binds polychlorinated biphenyls [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Scgb1a1

Proteins

uteroglobin precursor
Refseq ID NP_037183
Protein GI 6981694
UniProt ID P17559
mRNA ID NM_013051
Length 96
MKIAITITVLMLSICCSSASSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLCEQDLRV
sig_peptide: 1..19 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1999 peptide sequence: MKIAITITVLMLSICCSSA mat_peptide: 20..96 product: uteroglobin calculated_mol_wt: 8469 peptide sequence: SSDICPGFLQVLEALLLGSESNYEAALKPFNPASDLQNAGTQLKRLVDTLPQETRINIVKLTEKILTSPLCEQDLRV

Gene Information

Entrez Gene ID
25575
Gene Name
secretoglobin, family 1A, member 1 (uteroglobin)
Gene Symbol
Scgb1a1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:RGD C cytoplasm
GO:0005783 IDA:RGD C endoplasmic reticulum
GO:0005615 IDA:RGD C extracellular space
GO:0005635 IDA:RGD C nuclear envelope
GO:0005791 IDA:RGD C rough endoplasmic reticulum
GO:0030141 IDA:RGD C secretory granule
GO:0005488 IPI:RGD F binding
GO:0019834 IEA:UniProtKB-KW F phospholipase A2 inhibitor activity
GO:0042130 IEA:Ensembl P negative regulation of T cell proliferation
GO:0032689 IEA:Ensembl P negative regulation of interferon-gamma production
GO:0032696 IEA:Ensembl P negative regulation of interleukin-13 production
GO:0032713 IEA:Ensembl P negative regulation of interleukin-4 production
GO:0032714 IEA:Ensembl P negative regulation of interleukin-5 production
GO:0000122 IEA:Ensembl P negative regulation of transcription from RNA polymerase II promoter
GO:0050727 IEA:Ensembl P regulation of inflammatory response
GO:0043488 IEA:Ensembl P regulation of mRNA stability
GO:0034097 IMP:RGD P response to cytokine
GO:0042493 IEP:RGD P response to drug
GO:0071774 IEP:RGD P response to fibroblast growth factor
GO:0051384 IEP:RGD P response to glucocorticoid
GO:0032496 IEP:RGD P response to lipopolysaccharide
GO:0010033 IEP:RGD P response to organic substance
GO:0010193 IEP:RGD P response to ozone
GO:0034021 IEP:RGD P response to silicon dioxide
GO:0009410 IEP:RGD P response to xenobiotic stimulus

Domain Information

InterPro Annotations

Accession Description
IPR016126 Secretoglobin
IPR000329 Uteroglobin

UniProt Annotations

Entry Information

Gene Name
secretoglobin, family 1A, member 1 (uteroglobin)
Protein Entry
UTER_RAT
UniProt ID
P17559
Species
Rat

Comments

Comment Type Description
Function Binds phosphatidylcholine, phosphatidylinositol, polychlorinated biphenyls (PCB) and weakly progesterone, potent inhibitor of phospholipase A2.
Induction By glucocorticoids.
Similarity Belongs to the secretoglobin family
Subcellular Location Secreted.
Subunit Homodimer; antiparallel disulfide-linked.
Tissue Specificity Clara cells (nonciliated cells of the surface epithelium of the pulmonary airways).

Identical and Related Proteins

Unique RefSeq proteins for LMP012529 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6981694 RefSeq NP_037183 96 uteroglobin precursor

Identical Sequences to LMP012529 proteins

Reference Database Accession Length Protein Name
GI:6981694 GenBank AAH69174.1 96 Secretoglobin, family 1A, member 1 (uteroglobin) [Rattus norvegicus]
GI:6981694 GenBank EDM12772.1 96 secretoglobin, family 1A, member 1 (uteroglobin) [Rattus norvegicus]
GI:6981694 PDB 1UTR 96 Chain A, Uteroglobin-Pcb Complex (Reduced Form)
GI:6981694 PDB 1UTR 96 Chain B, Uteroglobin-Pcb Complex (Reduced Form)

Related Sequences to LMP012529 proteins

Reference Database Accession Length Protein Name
GI:6981694 GenBank AAA41817.1 96 PCB binding protein precursor [Rattus norvegicus]
GI:6981694 PDB 1UTR 96 Chain A, Uteroglobin-Pcb Complex (Reduced Form)
GI:6981694 SwissProt P17559.2 96 RecName: Full=Uteroglobin; AltName: Full=Clara cell phospholipid-binding protein; Short=CCPBP; AltName: Full=Clara cells 10 kDa secretory protein; Short=CC10; AltName: Full=PCB-binding protein; AltName: Full=Secretoglobin family 1A member 1; Flags: Precursor [Rattus norvegicus]