Gene/Proteome Database (LMPD)
LMPD ID
LMP012528
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
tocopherol (alpha) transfer protein
Gene Symbol
Synonyms
TTP;
Alternate Names
alpha-tocopherol transfer protein; alpha-TTP; Tocopherol transfer protein alpha;
Chromosome
5
Map Location
5q21
Summary
binds the vitamin tocopherol and enhances its transfer between separate membranes [RGD, Feb 2006]
Orthologs
Proteins
| alpha-tocopherol transfer protein | |
|---|---|
| Refseq ID | NP_037180 |
| Protein GI | 6981682 |
| UniProt ID | P41034 |
| mRNA ID | NM_013048 |
| Length | 278 |
| MAEMRPGPVVGKQLNEQPDHSPLVQPGLAELRRRAQEEGVPETPQPLTDAFLLRFLRARDFDLDLAWRLMKNYYKWRAECPELSADLHPRSILGLLKAGYHGVLRSRDPTGSRVLIYRISYWDPKVFTAYDVFRVSLITSELIVQEVETQRNGVKAIFDLEGWQISHAFQITPSVAKKIAAVVTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKGRIHLHGNNYKSSLLQHFPDILPLEYGGNESSMEDICQEWTNFIMKSEDYLSSISETIQ | |
Gene Information
Entrez Gene ID
Gene Name
tocopherol (alpha) transfer protein
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005829 | IDA:RGD | C | cytosol |
| GO:0005770 | IDA:RGD | C | late endosome |
| GO:0043325 | ISS:UniProtKB | F | phosphatidylinositol-3,4-bisphosphate binding |
| GO:0005546 | ISS:UniProtKB | F | phosphatidylinositol-4,5-bisphosphate binding |
| GO:0005215 | IEA:InterPro | F | transporter activity |
| GO:0008431 | IDA:RGD | F | vitamin E binding |
| GO:0019842 | IDA:RGD | F | vitamin binding |
| GO:0032502 | IEP:RGD | P | developmental process |
| GO:0001892 | IEA:Ensembl | P | embryonic placenta development |
| GO:0046909 | ISS:UniProtKB | P | intermembrane transport |
| GO:0051452 | IDA:RGD | P | intracellular pH reduction |
| GO:0060548 | IDA:RGD | P | negative regulation of cell death |
| GO:0090212 | IEA:Ensembl | P | negative regulation of establishment of blood-brain barrier |
| GO:0007584 | IEP:RGD | P | response to nutrient |
| GO:0009268 | IDA:RGD | P | response to pH |
| GO:0009636 | IEA:Ensembl | P | response to toxic substance |
| GO:0042360 | IDA:RGD | P | vitamin E metabolic process |
| GO:0051180 | ISS:UniProtKB | P | vitamin transport |
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Function | Binds alpha-tocopherol, enhances its transfer between separate membranes, and stimulates its release from liver cells. Binds both phosphatidylinol 3,4-bisphosphate and phosphatidylinol 4,5-bisphosphate; the resulting conformation change is important for the release of the bound alpha-tocopherol (By similarity) |
| Similarity | Contains 1 CRAL-TRIO domain. {ECO:0000255|PROSITE- ProRule:PRU00056}. |
| Subcellular Location | Cytoplasm. |
| Subunit | Monomer and homotetramer. Phosphatidylinol 4,5- bisphosphate binding induces the formation of homotetramers. Phosphatidylinol 3,4-bisphosphate is less efficient in inducing tetramerization (By similarity) |
| Tissue Specificity | Liver. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012528 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 6981682 | RefSeq | NP_037180 | 278 | alpha-tocopherol transfer protein |
Identical Sequences to LMP012528 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6981682 | DBBJ | BAA03843.1 | 278 | alpha-tocopherol transfer protein [Rattus norvegicus] |
| GI:6981682 | SwissProt | P41034.1 | 278 | RecName: Full=Alpha-tocopherol transfer protein; Short=Alpha-TTP [Rattus norvegicus] |
Related Sequences to LMP012528 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:6981682 | DBBJ | BAA03843.1 | 278 | alpha-tocopherol transfer protein [Rattus norvegicus] |
| GI:6981682 | GenBank | EDL98505.1 | 295 | tocopherol (alpha) transfer protein, isoform CRA_b [Rattus norvegicus] |
| GI:6981682 | SwissProt | P41034.1 | 278 | RecName: Full=Alpha-tocopherol transfer protein; Short=Alpha-TTP [Rattus norvegicus] |