Gene/Proteome Database (LMPD)

LMPD ID
LMP012516
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
lysophospholipase I
Gene Symbol
Synonyms
25KDL; Pla1a;
Alternate Names
acyl-protein thioesterase 1; APT-1; LPL-I; lysoPLA I; lysophospholipase 1;
Chromosome
5
Map Location
5q12
EC Number
3.1.2.-
Summary
may mediate cell death after hypoxic/ischemic cell injury [RGD, Feb 2006]
Orthologs

Proteins

acyl-protein thioesterase 1
Refseq ID NP_037138
Protein GI 6981362
UniProt ID P70470
mRNA ID NM_013006
Length 230
MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSSHIKYICPHAPVMPVTLNMSMMMPSWFDIIGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKGLVNPANVTFKVYEGMMHSSCQQEMMDVKYFIDKLLPPID

Gene Information

Entrez Gene ID
Gene Name
lysophospholipase I
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IEA:UniProtKB-KW C cytoplasm
GO:0004622 IDA:RGD F lysophospholipase activity
GO:0008474 ISS:UniProtKB F palmitoyl-(protein) hydrolase activity
GO:0006631 IEA:UniProtKB-KW P fatty acid metabolic process
GO:0098734 ISS:GOC P macromolecule depalmitoylation

KEGG Pathway Links

KEGG Pathway ID Description
ko00564 Glycerophospholipid metabolism
rno00564 Glycerophospholipid metabolism

REACTOME Pathway Links

REACTOME Pathway ID Description
5953250 Metabolism
5954034 Metabolism of nitric oxide
5954032 eNOS activation
5954033 eNOS activation and regulation

Domain Information

InterPro Annotations

Accession Description
IPR029058 Alpha/Beta hydrolase fold
IPR003140 Phospholipase/carboxylesterase/thioesterase

UniProt Annotations

Entry Information

Gene Name
lysophospholipase I
Protein Entry
LYPA1_RAT
UniProt ID
Species
Rat

Comments

Comment Type Description
Catalytic Activity Palmitoyl-protein + H(2)O = palmitate + protein.
Function Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS. Has depalmitoylating activity toward KCNMA1. Has low lysophospholipase activity (By similarity)
Similarity Belongs to the AB hydrolase superfamily. AB hydrolase 2 family
Subcellular Location Cytoplasm.
Subunit Homodimer
Tissue Specificity Ubiquitous. Detected at low levels in all tissues tested. {ECO:0000269|PubMed:8631810, ECO:0000269|PubMed:9644627}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012516 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6981362 RefSeq NP_037138 230 acyl-protein thioesterase 1

Identical Sequences to LMP012516 proteins

Reference Database Accession Length Protein Name
GI:6981362 GenBank AAX00648.1 230 Sequence 3 from patent US 6838245
GI:6981362 GenBank EDM11589.1 230 lysophospholipase 1 [Rattus norvegicus]
GI:6981362 GenBank AEU43498.1 230 Sequence 247 from patent US 8052970
GI:6981362 GenBank AEU43501.1 230 Sequence 250 from patent US 8052970

Related Sequences to LMP012516 proteins

Reference Database Accession Length Protein Name
GI:6981362 GenBank AAE01610.1 230 Sequence 3 from patent US 5858756
GI:6981362 GenBank AAE30798.1 230 Sequence 5 from patent US 5965423
GI:6981362 GenBank AAE41537.1 230 Sequence 3 from patent US 6004792