Gene/Proteome Database (LMPD)

LMPD ID
LMP012507
Gene ID
25404
Species
Rattus norvegicus (Rat)
Gene Name
caveolin 1, caveolae protein
Gene Symbol
Cav1
Synonyms
Cav;
Alternate Names
caveolin-1; caveolin caveolae protein 22 kDa;
Chromosome
4
Map Location
4q21
Summary
structural protein of lipid raft domains in the membrane called caveolae; functions as a cholesterol-binding/shuttling protein [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Cav1

Proteins

caveolin-1 isoform alpha
Refseq ID NP_113744
Protein GI 189083698
UniProt ID Q3MHT6
mRNA ID NM_031556
Length 178
MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI
caveolin-1 isoform beta
Refseq ID NP_598412
Protein GI 189083700
UniProt ID B1WBN8
mRNA ID NM_133651
Length 147
MADEVNEKQVYDAHTKEIDLVNRDPKHLNDDVVKIDFEDVIAEPEGTHSFDGIWKASFTTFTVTKYWFYRLLSTIFGIPMALIWGIYFAILSFLHIWAVVPCIKSFLIEIQCISRVYSIYVHTFCDPLFEAIGKIFSNIRISTQKEI

Gene Information

Entrez Gene ID
25404
Gene Name
caveolin 1, caveolae protein
Gene Symbol
Cav1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0000139 IEA:UniProtKB-SubCell C Golgi membrane
GO:0002080 IEA:Ensembl C acrosomal membrane
GO:0016324 IEA:Ensembl C apical plasma membrane
GO:0016323 IEA:Ensembl C basolateral plasma membrane
GO:0005901 IEA:UniProtKB-SubCell C caveola
GO:0005938 IEA:Ensembl C cell cortex
GO:0005929 IEA:Ensembl C cilium
GO:0005783 IEA:Ensembl C endoplasmic reticulum
GO:0005768 IEA:Ensembl C endosome
GO:0005887 IEA:Ensembl C integral component of plasma membrane
GO:0048471 IEA:Ensembl C perinuclear region of cytoplasm
GO:0043234 IEA:Ensembl C protein complex
GO:0016504 IEA:Ensembl F peptidase activator activity
GO:0005198 IEA:Ensembl F structural molecule activity
GO:0000165 IEA:Ensembl P MAPK cascade
GO:0031295 IEA:Ensembl P T cell costimulation
GO:0001525 IEA:Ensembl P angiogenesis
GO:0097190 IEA:Ensembl P apoptotic signaling pathway
GO:0006816 IEA:Ensembl P calcium ion transport
GO:0070836 IEA:Ensembl P caveola assembly
GO:0072584 IEA:Ensembl P caveolin-mediated endocytosis
GO:0071455 IEA:Ensembl P cellular response to hyperoxia
GO:0009267 IEA:Ensembl P cellular response to starvation
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0051480 IEA:Ensembl P cytosolic calcium ion homeostasis
GO:0000188 IEA:Ensembl P inactivation of MAPK activity
GO:0007595 IEA:Ensembl P lactation
GO:0019915 IEA:Ensembl P lipid storage
GO:0060056 IEA:Ensembl P mammary gland involution
GO:0051899 IEA:Ensembl P membrane depolarization
GO:0030514 IEA:Ensembl P negative regulation of BMP signaling pathway
GO:2000811 IEA:Ensembl P negative regulation of anoikis
GO:0090090 IEA:Ensembl P negative regulation of canonical Wnt signaling pathway
GO:0001960 IEA:Ensembl P negative regulation of cytokine-mediated signaling pathway
GO:0001937 IEA:Ensembl P negative regulation of endothelial cell proliferation
GO:0030857 IEA:Ensembl P negative regulation of epithelial cell differentiation
GO:0045019 IEA:Ensembl P negative regulation of nitric oxide biosynthetic process
GO:0051001 IEA:Ensembl P negative regulation of nitric-oxide synthase activity
GO:0033137 IEA:Ensembl P negative regulation of peptidyl-serine phosphorylation
GO:0048550 IEA:Ensembl P negative regulation of pinocytosis
GO:0032091 IEA:Ensembl P negative regulation of protein binding
GO:0031397 IEA:Ensembl P negative regulation of protein ubiquitination
GO:0000122 IEA:Ensembl P negative regulation of transcription from RNA polymerase II promoter
GO:0042524 IEA:Ensembl P negative regulation of tyrosine phosphorylation of Stat5 protein
GO:0033484 IEA:Ensembl P nitric oxide homeostasis
GO:0010524 IEA:Ensembl P positive regulation of calcium ion transport into cytosol
GO:0090263 IEA:Ensembl P positive regulation of canonical Wnt signaling pathway
GO:2001238 IEA:Ensembl P positive regulation of extrinsic apoptotic signaling pathway
GO:2001244 IEA:Ensembl P positive regulation of intrinsic apoptotic signaling pathway
GO:0048554 IEA:Ensembl P positive regulation of metalloenzyme activity
GO:0033138 IEA:Ensembl P positive regulation of peptidyl-serine phosphorylation
GO:0045907 IEA:Ensembl P positive regulation of vasoconstriction
GO:0051260 IEA:Ensembl P protein homooligomerization
GO:0008104 IEA:Ensembl P protein localization
GO:2000286 IEA:Ensembl P receptor internalization involved in canonical Wnt signaling pathway
GO:0030193 IEA:Ensembl P regulation of blood coagulation
GO:0019217 IEA:Ensembl P regulation of fatty acid metabolic process
GO:0006940 IEA:Ensembl P regulation of smooth muscle contraction
GO:0003057 IEA:Ensembl P regulation of the force of heart contraction by chemical signal
GO:0051592 IEA:Ensembl P response to calcium ion
GO:0043627 IEA:Ensembl P response to estrogen
GO:0001666 IEA:Ensembl P response to hypoxia
GO:0002931 IEA:Ensembl P response to ischemia
GO:0032570 IEA:Ensembl P response to progesterone
GO:0007519 IEA:Ensembl P skeletal muscle tissue development
GO:0006641 IEA:Ensembl P triglyceride metabolic process
GO:0001570 IEA:Ensembl P vasculogenesis
GO:0042310 IEA:Ensembl P vasoconstriction
GO:0016050 IEA:Ensembl P vesicle organization

KEGG Pathway Links

KEGG Pathway ID Description
ko05100 Bacterial invasion of epithelial cells
rno05100 Bacterial invasion of epithelial cells
ko04144 Endocytosis
rno04144 Endocytosis
ko04510 Focal adhesion
rno04510 Focal adhesion
ko05205 Proteoglycans in cancer
rno05205 Proteoglycans in cancer
rno05416 Viral myocarditis

REACTOME Pathway Links

REACTOME Pathway ID Description
5954052 Basigin interactions
5953650 Cell surface interactions at the vascular wall
5953253 Disease
5953645 Hemostasis
5953753 Hormone-sensitive lipase (HSL)-mediated triacylglycerol hydrolysis
5953754 Lipid digestion, mobilization, and transport
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954034 Metabolism of nitric oxide
5954043 NOSTRIN mediated eNOS trafficking
5954027 RNF mutants show enhanced WNT signaling and proliferation
5953381 Signal Transduction
5953420 Signaling by VEGF
5953965 Signaling by WNT in cancer
5953803 Signaling by Wnt
5954025 TCF dependent signaling in response to WNT
5953419 VEGFA-VEGFR2 Pathway
5953999 VEGFR2 mediated vascular permeability
5954028 XAV939 inhibits tankyrase, stabilizing AXIN
5954029 disassembly of the destruction complex and recruitment of AXIN to the membrane
5954032 eNOS activation
5954033 eNOS activation and regulation
5954026 misspliced LRP5 mutants have enhanced beta-catenin-dependent signaling

Domain Information

InterPro Annotations

Accession Description
IPR001612 Caveolin
IPR018361 Caveolin, conserved site
IPR015504 Caveolin_1

UniProt Annotations

Entry Information

Gene Name
caveolin 1, caveolae protein
Protein Entry
Q3MHT6_RAT
UniProt ID
Q3MHT6
Species
Rat

Comments

Comment Type Description
Function May act as a scaffolding protein within caveolar membranes. Interacts directly with G-protein alpha subunits and can functionally regulate their activity
Similarity Belongs to the caveolin family
Subcellular Location Golgi apparatus membrane ; Peripheral membrane protein . Cell membrane ; Peripheral membrane protein . Membrane, caveola ; Peripheral membrane protein .

Identical and Related Proteins

Unique RefSeq proteins for LMP012507 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
189083698 RefSeq NP_113744 178 caveolin-1 isoform alpha
189083700 RefSeq NP_598412 147 caveolin-1 isoform beta

Identical Sequences to LMP012507 proteins

Reference Database Accession Length Protein Name
GI:189083698 GenBank AAR16308.1 178 caveolin 1 [Rattus norvegicus]
GI:189083698 GenBank EDM15110.1 178 caveolin, isoform CRA_b [Rattus norvegicus]
GI:189083698 GenBank EDM15111.1 178 caveolin, isoform CRA_b [Rattus norvegicus]
GI:189083700 GenBank EDM15114.1 147 caveolin, isoform CRA_c [Rattus norvegicus]
GI:189083700 GenBank AAI61826.1 147 Cav1 protein [Rattus norvegicus]
GI:189083700 RefSeq XP_006236192.1 147 PREDICTED: caveolin-1 isoform X1 [Rattus norvegicus]
GI:189083700 RefSeq XP_006236193.1 147 PREDICTED: caveolin-1 isoform X1 [Rattus norvegicus]

Related Sequences to LMP012507 proteins

Reference Database Accession Length Protein Name
GI:189083698 GenBank AAR16308.1 178 caveolin 1 [Rattus norvegicus]
GI:189083698 GenBank EDM15110.1 178 caveolin, isoform CRA_b [Rattus norvegicus]
GI:189083698 GenBank EDM15111.1 178 caveolin, isoform CRA_b [Rattus norvegicus]
GI:189083700 GenBank EDM15113.1 147 caveolin, isoform CRA_c [Rattus norvegicus]
GI:189083700 GenBank EDM15114.1 147 caveolin, isoform CRA_c [Rattus norvegicus]
GI:189083700 GenBank AAI61826.1 147 Cav1 protein [Rattus norvegicus]