Gene/Proteome Database (LMPD)

LMPD ID
LMP012484
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Gene Symbol
Alternate Names
ubiquinone biosynthesis protein COQ7 homolog; demethyl-Q 7; timing protein clk-1 homolog; coenzyme Q biosynthesis protein 7 homolog; Coenzyme q (ubiquinone) biosynthetic enzyme (DHPB methyltransferase) 7;
Chromosome
1
Map Location
1q35
Summary
may play a roel in ubiquinone biosynthesis [RGD, Feb 2006]
Orthologs

Proteins

ubiquinone biosynthesis protein COQ7 homolog
Refseq ID NP_036917
Protein GI 472235294
mRNA ID NM_012785
Length 217
MSGAGAIAAASVGCLRTGVPRPFSAYGRGLIIRCHSTGMTLDNINRAAVDQIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMVAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRMLMEEDAEKYEELLQVIKQFRDEELEHHDTGLEHDAELAPAYTLLKRLIQAGCSAAIYLSERF

Gene Information

Entrez Gene ID
Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Gene Symbol
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005743 IEA:UniProtKB-KW C mitochondrial inner membrane
GO:0046872 IEA:UniProtKB-KW F metal ion binding
GO:0055114 IEA:InterPro P oxidation-reduction process
GO:0042493 IEP:RGD P response to drug
GO:0006744 IGI:RGD P ubiquinone biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
rno01100 Metabolic pathways
ko00130 Ubiquinone and other terpenoid-quinone biosynthesis
rno00130 Ubiquinone and other terpenoid-quinone biosynthesis
M00128 Ubiquinone biosynthesis, eukaryotes, 4-hydroxybenzoate => ubiquinone

Domain Information

InterPro Annotations

Accession Description
IPR009078 Ferritin-like superfamily
IPR011566 Ubiquinone biosynthesis protein Coq7

UniProt Annotations

Entry Information

Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Species
Rat

Comments

Comment Type Description
Cofactor Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; Note=Binds 2 iron ions per subunit. {ECO:0000250};
Function Involved in lifespan determination in ubiquinone- independent manner. Involved in ubiquinone biosynthesis. Potential central metabolic regulator (By similarity). {ECO:0000250}.
Pathway Cofactor biosynthesis; ubiquinone biosynthesis.
Similarity Belongs to the COQ7 family. {ECO:0000305}.
Subcellular Location Mitochondrion inner membrane; Peripheral membrane protein; Matrix side. Note=Synthesized as a preprotein that is imported into the mitochondrial matrix, where the sequence is cleaved off and the mature protein becomes loosely associated with the inner membrane. {ECO:0000250}.
Subunit Interacts with ADCK4 and COQ6. {ECO:0000250}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012484 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
472235294 RefSeq NP_036917 217 ubiquinone biosynthesis protein COQ7 homolog

Identical Sequences to LMP012484 proteins

Reference Database Accession Length Protein Name
GI:472235294 GenBank EDM17706.1 217 demethyl-Q 7, isoform CRA_b [Rattus norvegicus]

Related Sequences to LMP012484 proteins

Reference Database Accession Length Protein Name
GI:472235294 GenBank EDM17706.1 217 demethyl-Q 7, isoform CRA_b [Rattus norvegicus]
GI:472235294 RefSeq XP_005075678.1 216 PREDICTED: ubiquinone biosynthesis protein COQ7 homolog [Mesocricetus auratus]
GI:472235294 RefSeq XP_007632827.1 216 PREDICTED: ubiquinone biosynthesis protein COQ7 homolog isoform X2 [Cricetulus griseus]