Gene/Proteome Database (LMPD)
LMPD ID
LMP012484
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Gene Symbol
Alternate Names
ubiquinone biosynthesis protein COQ7 homolog; demethyl-Q 7; timing protein clk-1 homolog; coenzyme Q biosynthesis protein 7 homolog; Coenzyme q (ubiquinone) biosynthetic enzyme (DHPB methyltransferase) 7;
Chromosome
1
Map Location
1q35
Summary
may play a roel in ubiquinone biosynthesis [RGD, Feb 2006]
Orthologs
Proteins
| ubiquinone biosynthesis protein COQ7 homolog | |
|---|---|
| Refseq ID | NP_036917 |
| Protein GI | 472235294 |
| mRNA ID | NM_012785 |
| Length | 217 |
| MSGAGAIAAASVGCLRTGVPRPFSAYGRGLIIRCHSTGMTLDNINRAAVDQIIRVDHAGEYGANRIYAGQMAVLGRTSVGPVIQKMWDQEKNHLKKFNELMVAFRVRPTVLMPLWNVAGFALGAGTALLGKEGAMACTVAVEESIAHHYNNQIRMLMEEDAEKYEELLQVIKQFRDEELEHHDTGLEHDAELAPAYTLLKRLIQAGCSAAIYLSERF | |
Gene Information
Entrez Gene ID
Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005743 | IEA:UniProtKB-KW | C | mitochondrial inner membrane |
| GO:0046872 | IEA:UniProtKB-KW | F | metal ion binding |
| GO:0055114 | IEA:InterPro | P | oxidation-reduction process |
| GO:0042493 | IEP:RGD | P | response to drug |
| GO:0006744 | IGI:RGD | P | ubiquinone biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
coenzyme Q7 homolog, ubiquinone (yeast)
Species
Rat
Comments
| Comment Type | Description |
|---|---|
| Cofactor | Name=Fe cation; Xref=ChEBI:CHEBI:24875; Evidence={ECO:0000250}; Note=Binds 2 iron ions per subunit. {ECO:0000250}; |
| Function | Involved in lifespan determination in ubiquinone- independent manner. Involved in ubiquinone biosynthesis. Potential central metabolic regulator (By similarity). {ECO:0000250}. |
| Pathway | Cofactor biosynthesis; ubiquinone biosynthesis. |
| Similarity | Belongs to the COQ7 family. {ECO:0000305}. |
| Subcellular Location | Mitochondrion inner membrane; Peripheral membrane protein; Matrix side. Note=Synthesized as a preprotein that is imported into the mitochondrial matrix, where the sequence is cleaved off and the mature protein becomes loosely associated with the inner membrane. {ECO:0000250}. |
| Subunit | Interacts with ADCK4 and COQ6. {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012484 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 472235294 | RefSeq | NP_036917 | 217 | ubiquinone biosynthesis protein COQ7 homolog |
Identical Sequences to LMP012484 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:472235294 | GenBank | EDM17706.1 | 217 | demethyl-Q 7, isoform CRA_b [Rattus norvegicus] |
Related Sequences to LMP012484 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:472235294 | GenBank | EDM17706.1 | 217 | demethyl-Q 7, isoform CRA_b [Rattus norvegicus] |
| GI:472235294 | RefSeq | XP_005075678.1 | 216 | PREDICTED: ubiquinone biosynthesis protein COQ7 homolog [Mesocricetus auratus] |
| GI:472235294 | RefSeq | XP_007632827.1 | 216 | PREDICTED: ubiquinone biosynthesis protein COQ7 homolog isoform X2 [Cricetulus griseus] |