LIPID MAPS

LMPD ID

LMP012472

Gene ID

25116

Species

Rattus norvegicus (Rat)

Gene Name

hydroxysteroid 11-beta dehydrogenase 1

Gene Symbol

Hsd11b1

Synonyms

LRRGT00065;

Alternate Names

corticosteroid 11-beta-dehydrogenase isozyme 1; 11-DH; 11-beta-HSD1; cortocosteroid 11-beta dehydrogenase; 11-beta-hydroxysteroid dehydrogenase 1; hydroxysteroid dehydrogenase, 11 beta type 1;

Chromosome

13

Map Location

13q27

EC Number

1.1.1.146

Summary

catalyzes the interconversion of cortisol and cortisone; plays a role in glucocorticoid metabolism; may regulate blood pressure [RGD, Feb 2006]

Orthologs

View orthologs and multiple alignments for Hsd11b1

corticosteroid 11-beta-dehydrogenase isozyme 1
Refseq ID	NP_058776
Protein GI	78214365
UniProt ID	P16232
mRNA ID	NM_017080
Length	288
MKKYLLPVLVLCLGYYYSTNEEFRPEMLQGKKVIVTGASKGIGREMAYHLSKMGAHVVLTARSEEGLQKVVSRCLELGAASAHYIAGTMEDMAFAERFVVEAGKLLGGLDMLILNHITQTTMSLFHDDIHSVRRSMEVNFLSYVVLSTAALPMLKQSNGSIAIISSMAGKMTQPLIASYSASKFALDGFFSTIRKEHLMTKVNVSITLCVLGFIDTETALKETSGIILSQAAPKEECALEIIKGTVLRKDEVYYDKSSWTPLLLGNPGRRIMEFLSLRSYNRDLFVSN

Entrez Gene ID

25116

Gene Name

hydroxysteroid 11-beta dehydrogenase 1

Gene Symbol

Hsd11b1

Species

Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID	Source	Type	Description
GO:0045177	IDA:RGD	C	apical part of cell
GO:0005737	IDA:RGD	C	cytoplasm
GO:0016021	IEA:UniProtKB-KW	C	integral component of membrane
GO:0043231	IDA:RGD	C	intracellular membrane-bounded organelle
GO:0031965	IDA:RGD	C	nuclear membrane
GO:0005791	IDA:RGD	C	rough endoplasmic reticulum
GO:0070524	IEA:UniProtKB-EC	F	11-beta-hydroxysteroid dehydrogenase (NADP+) activity
GO:0003845	IDA:RGD	F	11-beta-hydroxysteroid dehydrogenase [NAD(P)] activity
GO:0050661	IDA:RGD	F	NADP binding
GO:0016491	IDA:RGD	F	oxidoreductase activity
GO:0005496	IPI:RGD	F	steroid binding
GO:0071392	IEP:RGD	P	cellular response to estradiol stimulus
GO:0006704	IDA:RGD	P	glucocorticoid biosynthetic process
GO:0006713	IDA:RGD	P	glucocorticoid catabolic process
GO:0008152	IDA:RGD	P	metabolic process
GO:0018963	IEP:RGD	P	phthalate metabolic process
GO:0043456	IDA:RGD	P	regulation of pentose-phosphate shunt
GO:0031667	IEP:RGD	P	response to nutrient levels

KEGG Pathway Links

KEGG Pathway ID	Description
M00109	C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
ko05204	Chemical carcinogenesis
rno05204	Chemical carcinogenesis
rno01100	Metabolic pathways
ko00980	Metabolism of xenobiotics by cytochrome P450
rno00980	Metabolism of xenobiotics by cytochrome P450
ko00140	Steroid hormone biosynthesis
rno00140	Steroid hormone biosynthesis

InterPro Annotations

Accession	Description
IPR002347	Glucose/ribitol dehydrogenase
IPR016040	NAD(P)-binding domain
IPR002198	Short-chain dehydrogenase/reductase SDR
IPR020904	Short-chain dehydrogenase/reductase, conserved site

Entry Information

Gene Name

hydroxysteroid 11-beta dehydrogenase 1

Protein Entry

DHI1_RAT

UniProt ID

P16232

Species

Rat

Comments

Comment Type	Description
Alternative Products	Event=Alternative promoter usage; Named isoforms=2; Name=11-HSD1A; IsoId=P16232-1; Sequence=Displayed; Name=11-HSD1B; IsoId=P16232-2; Sequence=VSP_012616; Note=Kidney-specific.;
Catalytic Activity	An 11-beta-hydroxysteroid + NADP(+) = an 11- oxosteroid + NADPH.
Developmental Stage	Expression of both isoforms is found in 1 week-old rats. Expression increases exponentially up to 4 weeks but after this time there is no further increase up to 16 weeks.
Function	Catalyzes reversibly the conversion of corticosterone to 11-dehydrocorticosterone.
Ptm	Glycosylated.
Similarity	Belongs to the short-chain dehydrogenases/reductases (SDR) family
Subcellular Location	Endoplasmic reticulum membrane; Single-pass type II membrane protein.
Subunit	Homodimer
Tissue Specificity	Liver, kidney, testis and placenta.

Unique RefSeq proteins for LMP012472 (as displayed in Record Overview)

Protein GI	Database	Accession	Length	Protein Name
78214365	RefSeq	NP_058776	288	corticosteroid 11-beta-dehydrogenase isozyme 1

Identical Sequences to LMP012472 proteins

Reference	Database	Accession	Length	Protein Name
GI:78214365	GenBank	AAH78865.1	288	Hydroxysteroid 11-beta dehydrogenase 1 [Rattus norvegicus]
GI:78214365	GenBank	EDL95031.1	288	hydroxysteroid 11-beta dehydrogenase 1, isoform CRA_a [Rattus norvegicus]
GI:78214365	GenBank	EDL95032.1	288	hydroxysteroid 11-beta dehydrogenase 1, isoform CRA_a [Rattus norvegicus]
GI:78214365	RefSeq	XP_006250535.1	288	PREDICTED: corticosteroid 11-beta-dehydrogenase isozyme 1 isoform X1 [Rattus norvegicus]

Related Sequences to LMP012472 proteins

Reference	Database	Accession	Length	Protein Name
GI:78214365	GenBank	AAH78865.1	288	Hydroxysteroid 11-beta dehydrogenase 1 [Rattus norvegicus]
GI:78214365	GenBank	EDL95032.1	288	hydroxysteroid 11-beta dehydrogenase 1, isoform CRA_a [Rattus norvegicus]
GI:78214365	SwissProt	P16232.2	288	RecName: Full=Corticosteroid 11-beta-dehydrogenase isozyme 1; AltName: Full=11-beta-hydroxysteroid dehydrogenase 1; Short=11-DH; Short=11-beta-HSD1 [Rattus norvegicus]