Gene/Proteome Database (LMPD)

LMPD ID
LMP012467
Gene ID
25081
Species
Rattus norvegicus (Rat)
Gene Name
apolipoprotein A-I
Gene Symbol
Apoa1
Synonyms
apoA-I;
Alternate Names
apolipoprotein A-I; apo-AI; apolipoprotein A1; apolipoprotein A-1; preproapolipoprotein A-I;
Chromosome
8
Map Location
8q23-q24
Summary
major component of high density lipoprotein (HDL) that is involved in intercellular cholesterol transport in astrocytes; cofactor for lecithin cholesterolacyltransferase (LCAT) [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Apoa1

Proteins

apolipoprotein A-I preproprotein
Refseq ID NP_036870
Protein GI 6978515
UniProt ID P04639
mRNA ID NM_012738
Length 259
MKAAVLAVALVFLTGCQAWEFWQQDEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESSTLGKQLNLNLLDNWDTLGSTVGRLQEQLGPVTQEFWANLEKETDWLRNEMNKDLENVKQKMQPHLDEFQEKWNEEVEAYRQKLEPLGTELHKNAKEMQRHLKVVAEEFRDRMRVNADALRAKFGLYSDQMRENLAQRLTEIKNHPTLIEYHTKASDHLKTLGEKAKPALDDLGQGLMPVLEAWKAKIMSMIDEAKKKLNA
sig_peptide: 1..18 inference: COORDINATES: ab initio prediction:SignalP:4.0 calculated_mol_wt: 1806 peptide sequence: MKAAVLAVALVFLTGCQA mat_peptide: 25..259 product: apolipoprotein A-I calculated_mol_wt: 27369 peptide sequence: DEPQSQWDRVKDFATVYVDAVKDSGRDYVSQFESSTLGKQLNLNLLDNWDTLGSTVGRLQEQLGPVTQEFWANLEKETDWLRNEMNKDLENVKQKMQPHLDEFQEKWNEEVEAYRQKLEPLGTELHKNAKEMQRHLKVVAEEFRDRMRVNADALRAKFGLYSDQMRENLAQRLTEIKNHPTLIEYHTKASDHLKTLGEKAKPALDDLGQGLMPVLEAWKAKIMSMIDEAKKKLNA

Gene Information

Entrez Gene ID
25081
Gene Name
apolipoprotein A-I
Gene Symbol
Apoa1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0072562 IEA:Ensembl C blood microparticle
GO:0009986 IDA:RGD C cell surface
GO:0034365 IDA:RGD C discoidal high-density lipoprotein particle
GO:0030139 IEA:Ensembl C endocytic vesicle
GO:0005615 IDA:RGD C extracellular space
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005634 IDA:RGD C nucleus
GO:0034366 IEA:Ensembl C spherical high-density lipoprotein particle
GO:0034361 IEA:Ensembl C very-low-density lipoprotein particle
GO:0001540 IEA:Ensembl F beta-amyloid binding
GO:0015485 IEA:Ensembl F cholesterol binding
GO:0017127 IDA:RGD F cholesterol transporter activity
GO:0008035 IEA:Ensembl F high-density lipoprotein particle binding
GO:0055102 IDA:RGD F lipase inhibitor activity
GO:0060228 IEA:Ensembl F phosphatidylcholine-sterol O-acyltransferase activator activity
GO:0005543 IEA:Ensembl F phospholipid binding
GO:0005548 IDA:RGD F phospholipid transporter activity
GO:0007186 IEA:Ensembl P G-protein coupled receptor signaling pathway
GO:0030325 IEA:Ensembl P adrenal gland development
GO:0043534 IEA:Ensembl P blood vessel endothelial cell migration
GO:0006695 IEA:Ensembl P cholesterol biosynthetic process
GO:0033344 IEA:Ensembl P cholesterol efflux
GO:0042632 IEA:Ensembl P cholesterol homeostasis
GO:0070508 IEA:Ensembl P cholesterol import
GO:0030301 IDA:RGD P cholesterol transport
GO:0001935 IEA:Ensembl P endothelial cell proliferation
GO:0008211 IEA:Ensembl P glucocorticoid metabolic process
GO:0034380 IEA:Ensembl P high-density lipoprotein particle assembly
GO:0019915 IEA:Ensembl P lipid storage
GO:0042158 IEA:Ensembl P lipoprotein biosynthetic process
GO:0060354 IEA:Ensembl P negative regulation of cell adhesion molecule production
GO:0002740 IEA:Ensembl P negative regulation of cytokine secretion involved in immune response
GO:0034115 IEA:Ensembl P negative regulation of heterotypic cell-cell adhesion
GO:0050728 IEA:Ensembl P negative regulation of inflammatory response
GO:0050713 IEA:Ensembl P negative regulation of interleukin-1 beta secretion
GO:0060192 IDA:RGD P negative regulation of lipase activity
GO:0010804 IEA:Ensembl P negative regulation of tumor necrosis factor-mediated signaling pathway
GO:0010903 IEA:Ensembl P negative regulation of very-low-density lipoprotein particle remodeling
GO:0031100 IDA:RGD P organ regeneration
GO:0018206 IEA:Ensembl P peptidyl-methionine modification
GO:0014012 IEP:RGD P peripheral nervous system axon regeneration
GO:0006656 IEA:Ensembl P phosphatidylcholine biosynthetic process
GO:0033700 IEA:Ensembl P phospholipid efflux
GO:0055091 IEA:Ensembl P phospholipid homeostasis
GO:0015914 IDA:RGD P phospholipid transport
GO:0010873 IEA:Ensembl P positive regulation of cholesterol esterification
GO:0051345 IEA:Ensembl P positive regulation of hydrolase activity
GO:0051347 IEA:Ensembl P positive regulation of transferase activity
GO:0018158 IEA:Ensembl P protein oxidation
GO:0050821 IEA:Ensembl P protein stabilization
GO:0032489 IEA:Ensembl P regulation of Cdc42 protein signal transduction
GO:0030300 IEA:Ensembl P regulation of intestinal cholesterol absorption
GO:0001932 IEA:Ensembl P regulation of protein phosphorylation
GO:0042493 IEP:RGD P response to drug
GO:0043627 IEP:RGD P response to estrogen
GO:0007584 IEP:RGD P response to nutrient
GO:0043691 IEA:Ensembl P reverse cholesterol transport
GO:0070328 IEA:Ensembl P triglyceride homeostasis

KEGG Pathway Links

KEGG Pathway ID Description
ko05143 African trypanosomiasis
rno05143 African trypanosomiasis
ko04975 Fat digestion and absorption
rno04975 Fat digestion and absorption
ko03320 PPAR signaling pathway
rno03320 PPAR signaling pathway
ko04977 Vitamin digestion and absorption
rno04977 Vitamin digestion and absorption

REACTOME Pathway Links

REACTOME Pathway ID Description
5954099 ABC-family proteins mediated transport
5954098 ABCA transporters in lipid homeostasis
5954397 Amyloids
5954562 Binding and Uptake of Ligands by Scavenger Receptors
5953879 Chylomicron-mediated lipid transport
5953253 Disease
5953382 Diseases associated with visual transduction
5953288 Fatty acid, triacylglycerol, and ketone body metabolism
5954088 HDL-mediated lipid transport
5953645 Hemostasis
5953754 Lipid digestion, mobilization, and transport
5953836 Lipoprotein metabolism
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5954333 PPARA activates gene expression
5953644 Platelet activation, signaling and aggregation
5954102 Platelet degranulation
5954222 Regulation of lipid metabolism by Peroxisome proliferator-activated receptor alpha (PPARalpha)
5953646 Response to elevated platelet cytosolic Ca2+
5954392 Retinoid metabolism and transport
5954564 Scavenging by Class A Receptors
5954565 Scavenging by Class B Receptors
5954561 Scavenging of heme from plasma
5953381 Signal Transduction
5953265 Transmembrane transport of small molecules
5953380 Visual phototransduction

Domain Information

InterPro Annotations

Accession Description
IPR000074 Apolipoprotein A/E

UniProt Annotations

Entry Information

Gene Name
apolipoprotein A-I
Protein Entry
APOA1_RAT
UniProt ID
P04639
Species
Rat

Comments

Comment Type Description
Function Participates in the reverse transport of cholesterol from tissues to the liver for excretion by promoting cholesterol efflux from tissues and by acting as a cofactor for the lecithin cholesterol acyltransferase (LCAT). As part of the SPAP complex, activates spermatozoa motility.
Ptm Glycosylated
Ptm Palmitoylated
Ptm Phosphorylation sites are present in the extracellular medium
Similarity Belongs to the apolipoprotein A1/A4/E family
Subcellular Location Secreted.
Subunit Interacts with APOA1BP and CLU. Component of a sperm activating protein complex (SPAP), consisting of APOA1, an immunoglobulin heavy chain, an immunoglobulin light chain and albumin. Interacts with NDRG1 (By similarity)
Tissue Specificity Major protein of plasma HDL, also found in chylomicrons.

Identical and Related Proteins

Unique RefSeq proteins for LMP012467 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
6978515 RefSeq NP_036870 259 apolipoprotein A-I preproprotein

Identical Sequences to LMP012467 proteins

Reference Database Accession Length Protein Name
GI:6978515 GenBank AAA40745.1 259 preapolipoprotein A-I [Rattus norvegicus]
GI:6978515 GenBank AAA40749.1 259 apolipoprotein A-I precursor [Rattus norvegicus]
GI:6978515 GenBank AAH89820.1 259 Apolipoprotein A-I [Rattus norvegicus]
GI:6978515 SwissProt P04639.2 259 RecName: Full=Apolipoprotein A-I; Short=Apo-AI; Short=ApoA-I; AltName: Full=Apolipoprotein A1; Contains: RecName: Full=Proapolipoprotein A-I; Short=ProapoA-I; Flags: Precursor [Rattus norvegicus]

Related Sequences to LMP012467 proteins

Reference Database Accession Length Protein Name
GI:6978515 GenBank AAA40745.1 259 preapolipoprotein A-I [Rattus norvegicus]
GI:6978515 GenBank AAA40749.1 259 apolipoprotein A-I precursor [Rattus norvegicus]
GI:6978515 SwissProt P04639.2 259 RecName: Full=Apolipoprotein A-I; Short=Apo-AI; Short=ApoA-I; AltName: Full=Apolipoprotein A1; Contains: RecName: Full=Proapolipoprotein A-I; Short=ProapoA-I; Flags: Precursor [Rattus norvegicus]