Gene/Proteome Database (LMPD)

LMPD ID
LMP012448
Gene ID
24912
Species
Rattus norvegicus (Rat)
Gene Name
sulfotransferase family 2A, dehydroepiandrosterone (DHEA)-preferring, member 1
Gene Symbol
Sult2a1
Synonyms
STa; St2; Sth2; Smp-2; St2a1;
Alternate Names
bile salt sulfotransferase; ST; ST-20; sulfotransferase 2A1; alcohol sulfotransferase; bile-salt sulfotransferase 2A1; hydroxysteroid sulfotransferase a; sulfotransferase hydroxysteroid gene 2; sulfotransferase, hydroxysteroid preferring 2; sulfotransferase family, cytosolic, 2A, dehydroepiandrosterone (DHEA) -preferring, member 1;
Chromosome
1
Map Location
1q21.3-q22.1
EC Number
2.8.2.14
Summary
catalyses the metabolic activation of potent carcinogenic polycyclic arylmethanols [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Sult2a1

Proteins

bile salt sulfotransferase
Refseq ID NP_571978
Protein GI 222831686
UniProt ID P15709
mRNA ID NM_131903
Length 284
MPDYTWFEGIPFHAFGISKETLQNVCNKFVVKEEDLILLAYPKSGTNWLIEIVCLIQTKGDPKWIQSVTIWDRSPWIETDVGYDILIKKKGPRLMTSHLPMHLFSKSLFSSKAKVIYLIRNPRDVLVSGYYFWGNSTLVKKPDSLGTYVEWFLKGNVLYGSWFEHIRAWLSMREWDNFLLLYYEDMKKDTMGTIKKICDFLGKKLEPDELDLVLKYSSFQVMKENDMSNYSLLMKKSIFTGIGLMRKGTIGDWKNHFTVSQAEAFDKVFQEKMAGFPPGMFPWE

Gene Information

Entrez Gene ID
24912
Gene Name
sulfotransferase family 2A, dehydroepiandrosterone (DHEA)-preferring, member 1
Gene Symbol
Sult2a1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:RGD C cytoplasm
GO:0005829 IDA:RGD C cytosol
GO:0050656 IDA:RGD F 3'-phosphoadenosine 5'-phosphosulfate binding
GO:0004027 IDA:RGD F alcohol sulfotransferase activity
GO:0047704 IEA:UniProtKB-EC F bile-salt sulfotransferase activity
GO:0008144 IDA:RGD F drug binding
GO:0008146 IDA:RGD F sulfotransferase activity
GO:0016740 IDA:RGD F transferase activity
GO:0007568 IEP:RGD P aging
GO:0071305 IDA:RGD P cellular response to vitamin D
GO:0017144 IDA:RGD P drug metabolic process
GO:0014823 IEP:RGD P response to activity
GO:0017085 IEP:RGD P response to insecticide
GO:0031667 IEP:RGD P response to nutrient levels
GO:0008202 IDA:RGD P steroid metabolic process
GO:0051923 IDA:RGD P sulfation

KEGG Pathway Links

KEGG Pathway ID Description
ko04976 Bile secretion
rno04976 Bile secretion
ko05204 Chemical carcinogenesis
rno05204 Chemical carcinogenesis
ko00980 Metabolism of xenobiotics by cytochrome P450
rno00980 Metabolism of xenobiotics by cytochrome P450

Domain Information

InterPro Annotations

Accession Description
IPR027417 P-loop containing nucleoside triphosphate hydrolase
IPR000863 Sulfotransferase domain

UniProt Annotations

Entry Information

Gene Name
sulfotransferase family 2A, dehydroepiandrosterone (DHEA)-preferring, member 1
Protein Entry
ST2A1_RAT
UniProt ID
P15709
Species
Rat

Comments

Comment Type Description
Catalytic Activity 3'-phosphoadenylyl sulfate + glycolithocholate = adenosine 3',5'-bisphosphate + glycolithocholate 3-sulfate.
Catalytic Activity 3'-phosphoadenylyl sulfate + taurolithocholate = adenosine 3',5'-bisphosphate + taurolithocholate sulfate.
Developmental Stage There is a marked sex difference (female >> male) in the expressed level of mRNA for this protein.
Function Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze sulfonation of hydroxysteroids and xenobiotics. Bioactivation of carcinogenic polycyclic arylmethanols.
Induction Induced by estrogens and suppressed by androgens. Expression is under the influence of pituitary growth hormone and thyroid hormone.
Similarity Belongs to the sulfotransferase 1 family
Subcellular Location Cytoplasm.

Identical and Related Proteins

Unique RefSeq proteins for LMP012448 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
222831686 RefSeq NP_571978 284 bile salt sulfotransferase

Identical Sequences to LMP012448 proteins

Reference Database Accession Length Protein Name
GI:222831686 DBBJ BAA03632.1 284 hydroxysteroid sulfotransferase [Rattus norvegicus]
GI:222831686 DBBJ BAA03633.1 284 hydroxysteroid sulfotransferase [Rattus norvegicus]
GI:222831686 SwissProt P15709.3 284 RecName: Full=Bile salt sulfotransferase; AltName: Full=Hydroxysteroid sulfotransferase; Short=ST; AltName: Full=ST-20; AltName: Full=Sulfotransferase 2A1; Short=ST2A1 [Rattus norvegicus]

Related Sequences to LMP012448 proteins

Reference Database Accession Length Protein Name
GI:222831686 DBBJ BAA03632.1 284 hydroxysteroid sulfotransferase [Rattus norvegicus]
GI:222831686 DBBJ BAA03633.1 284 hydroxysteroid sulfotransferase [Rattus norvegicus]
GI:222831686 SwissProt P15709.3 284 RecName: Full=Bile salt sulfotransferase; AltName: Full=Hydroxysteroid sulfotransferase; Short=ST; AltName: Full=ST-20; AltName: Full=Sulfotransferase 2A1; Short=ST2A1 [Rattus norvegicus]