Gene/Proteome Database (LMPD)

LMPD ID
LMP012428
Gene ID
24705
Species
Rattus norvegicus (Rat)
Gene Name
retinoic acid receptor, alpha
Gene Symbol
Rara
Alternate Names
retinoic acid receptor alpha;
Chromosome
10
Map Location
10q31
Summary
mediates all-trans-retinoic acid induction of mitogen-activated protein kinase phosphatase 1 (MKP-1); contributes to regulation of oxidative stress-induced anti-apoptosis [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Rara

Proteins

retinoic acid receptor alpha
Refseq ID NP_113716
Protein GI 158262026
UniProt ID Q499N1
mRNA ID NM_031528
Length 459
MYESVEVGGLAPAPNPFLVVDFYNQNRACLLQEKGLPAPGPYSTPLRTPLWNGSNHSIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDKVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLDTLSGQSGGGTRDGGGLAPPPGSCSPSLSPSSHRSSPATQSP

Gene Information

Entrez Gene ID
24705
Gene Name
retinoic acid receptor, alpha
Gene Symbol
Rara
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005737 IDA:RGD C cytoplasm
GO:0030425 IDA:RGD C dendrite
GO:0043005 IDA:RGD C neuron projection
GO:0043025 IEA:Ensembl C neuronal cell body
GO:0000790 IEA:Ensembl C nuclear chromatin
GO:0005634 IDA:RGD C nucleus
GO:0048471 IDA:RGD C perinuclear region of cytoplasm
GO:0000977 IEA:Ensembl F RNA polymerase II regulatory region sequence-specific DNA binding
GO:0031490 IEA:Ensembl F chromatin DNA binding
GO:0008144 IDA:RGD F drug binding
GO:0048027 IDA:RGD F mRNA 5'-UTR binding
GO:0035014 IMP:UniProtKB F phosphatidylinositol 3-kinase regulator activity
GO:0001972 IEA:Ensembl F retinoic acid binding
GO:0003708 IDA:RGD F retinoic acid receptor activity
GO:0044323 IEA:Ensembl F retinoic acid-responsive element binding
GO:0003707 IEA:InterPro F steroid hormone receptor activity
GO:0003713 IEA:Ensembl F transcription coactivator activity
GO:0003714 IEA:Ensembl F transcription corepressor activity
GO:0008134 IPI:RGD F transcription factor binding
GO:0000900 IDA:RGD F translation repressor activity, nucleic acid binding
GO:0008270 IEA:InterPro F zinc ion binding
GO:0060010 IEA:Ensembl P Sertoli cell fate commitment
GO:0043277 IEA:Ensembl P apoptotic cell clearance
GO:0071391 IEA:Ensembl P cellular response to estrogen stimulus
GO:0071222 IEA:Ensembl P cellular response to lipopolysaccharide
GO:0071300 IEA:Ensembl P cellular response to retinoic acid
GO:0060591 IEA:Ensembl P chondroblast differentiation
GO:0031076 IEA:Ensembl P embryonic camera-type eye development
GO:0060324 IEA:Ensembl P face development
GO:0007565 IEP:RGD P female pregnancy
GO:0007281 IEA:Ensembl P germ cell development
GO:0002068 IEA:Ensembl P glandular epithelial cell development
GO:0003417 IEA:Ensembl P growth plate cartilage development
GO:0021766 IEP:RGD P hippocampus development
GO:0030520 IEA:Ensembl P intracellular estrogen receptor signaling pathway
GO:0060173 IEA:Ensembl P limb development
GO:0001889 IEP:RGD P liver development
GO:0008584 IDA:RGD P male gonad development
GO:0035264 IEA:Ensembl P multicellular organism growth
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0061037 IEA:Ensembl P negative regulation of cartilage development
GO:0008285 IDA:RGD P negative regulation of cell proliferation
GO:0030853 IEA:Ensembl P negative regulation of granulocyte differentiation
GO:0032689 IEA:Ensembl P negative regulation of interferon-gamma production
GO:0000122 IEA:Ensembl P negative regulation of transcription from RNA polymerase II promoter
GO:0017148 IDA:RGD P negative regulation of translation
GO:0045947 IEA:Ensembl P negative regulation of translational initiation
GO:0032720 IEA:Ensembl P negative regulation of tumor necrosis factor production
GO:0001843 IEA:Ensembl P neural tube closure
GO:0003148 IEA:Ensembl P outflow tract septum morphogenesis
GO:0070374 IMP:UniProtKB P positive regulation of ERK1 and ERK2 cascade
GO:0045630 IEA:Ensembl P positive regulation of T-helper 2 cell differentiation
GO:0051099 IEA:Ensembl P positive regulation of binding
GO:0045787 IEA:Ensembl P positive regulation of cell cycle
GO:0008284 IEA:Ensembl P positive regulation of cell proliferation
GO:0032736 IEA:Ensembl P positive regulation of interleukin-13 production
GO:0032753 IEA:Ensembl P positive regulation of interleukin-4 production
GO:0032754 IEA:Ensembl P positive regulation of interleukin-5 production
GO:0045666 IDA:RGD P positive regulation of neuron differentiation
GO:0014068 IMP:UniProtKB P positive regulation of phosphatidylinositol 3-kinase signaling
GO:0051897 IMP:UniProtKB P positive regulation of protein kinase B signaling
GO:0045944 IEA:Ensembl P positive regulation of transcription from RNA polymerase II promoter
GO:0030850 IEP:RGD P prostate gland development
GO:0006468 IEA:Ensembl P protein phosphorylation
GO:0042981 IDA:RGD P regulation of apoptotic process
GO:0031641 IDA:RGD P regulation of myelination
GO:0043551 IMP:GOC P regulation of phosphatidylinositol 3-kinase activity
GO:0048167 IDA:RGD P regulation of synaptic plasticity
GO:0034097 IEP:RGD P response to cytokine
GO:0032355 IEP:RGD P response to estradiol
GO:0045471 IDA:RGD P response to ethanol
GO:0033189 IEP:RGD P response to vitamin A
GO:0048384 IDA:RGD P retinoic acid receptor signaling pathway
GO:0007283 IEA:Ensembl P spermatogenesis
GO:0060534 IEA:Ensembl P trachea cartilage development
GO:0001657 IEA:Ensembl P ureteric bud development
GO:0055012 IEA:Ensembl P ventricular cardiac muscle cell differentiation

KEGG Pathway Links

KEGG Pathway ID Description
ko05221 Acute myeloid leukemia
rno05221 Acute myeloid leukemia
rno05200 Pathways in cancer
ko05202 Transcriptional misregulation in cancer
rno05202 Transcriptional misregulation in cancer

REACTOME Pathway Links

REACTOME Pathway ID Description
5953330 Gene Expression
5953833 Generic Transcription Pathway
5954147 Nuclear Receptor transcription pathway

Domain Information

InterPro Annotations

Accession Description
IPR008946 Nuclear hormone receptor, ligand-binding
IPR000536 Nuclear hormone receptor, ligand-binding, core
IPR003078 Retinoic acid receptor
IPR001723 Steroid hormone receptor
IPR013088 Zinc finger, NHR/GATA-type
IPR001628 Zinc finger, nuclear hormone receptor-type

UniProt Annotations

Entry Information

Gene Name
retinoic acid receptor, alpha
Protein Entry
Q499N1_RAT
UniProt ID
Q499N1
Species
Rat

Comments

Comment Type Description
Similarity Belongs to the nuclear hormone receptor family
Similarity Contains nuclear receptor DNA-binding domain

Identical and Related Proteins

Unique RefSeq proteins for LMP012428 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
158262026 RefSeq NP_113716 459 retinoic acid receptor alpha

Identical Sequences to LMP012428 proteins

Reference Database Accession Length Protein Name
GI:158262026 GenBank AAH99830.1 459 Retinoic acid receptor, alpha [Rattus norvegicus]
GI:158262026 GenBank EDM05964.1 459 retinoic acid receptor, alpha, isoform CRA_b [Rattus norvegicus]

Related Sequences to LMP012428 proteins

Reference Database Accession Length Protein Name
GI:158262026 GenBank AAH99830.1 459 Retinoic acid receptor, alpha [Rattus norvegicus]
GI:158262026 GenBank EDM05964.1 459 retinoic acid receptor, alpha, isoform CRA_b [Rattus norvegicus]
GI:158262026 RefSeq NP_001169999.1 459 retinoic acid receptor alpha isoform 2 [Mus musculus]