Gene/Proteome Database (LMPD)

LMPD ID
LMP012405
Gene ID
24404
Species
Rattus norvegicus (Rat)
Gene Name
glutathione peroxidase 1
Gene Symbol
Gpx1
Synonyms
GSHPx; GSHPx-1;
Alternate Names
glutathione peroxidase 1; GPx-1; cellular glutathione peroxidase;
Chromosome
8
Map Location
chromosome:8
Summary
This gene product belongs to the family of glutathione peroxidase, which functions in the detoxification of hydrogen peroxide. It contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon, which normally signals translation termination. The 3' UTR of Sec-containing genes have a common stem-loop structure, the sec insertion sequence (SECIS), which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. [provided by RefSeq, Jul 2008]
Orthologs
View orthologs and multiple alignments for Gpx1

Proteins

glutathione peroxidase 1
Refseq ID NP_110453
Protein GI 145275165
UniProt ID Q6PDW8
mRNA ID NM_030826
Length 201
MSAARLSAVAQSTVYAFSARPLAGGEPVSLGSLRGKVLLIENVASLUGTTTRDYTEMNDLQKRLGPRGLVVLGFPCNQFGHQENGKNEEILNSLKYVRPGGGFEPNFTLFEKCEVNGEKAHPLFTFLRNALPAPSDDPTALMTDPKYIIWSPVCRNDISWNFEKFLVGPDGVPVRRYSRRFRTIDIEPDIEALLSKQPSNP

Gene Information

Entrez Gene ID
24404
Gene Name
glutathione peroxidase 1
Gene Symbol
Gpx1
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0070062 IEA:Ensembl C extracellular vesicular exosome
GO:0005739 IEA:Ensembl C mitochondrion
GO:0004602 IEA:Ensembl F glutathione peroxidase activity
GO:0009650 IEA:Ensembl P UV protection
GO:0060055 IEA:Ensembl P angiogenesis involved in wound healing
GO:0043534 IEA:Ensembl P blood vessel endothelial cell migration
GO:0045454 IEA:Ensembl P cell redox homeostasis
GO:0001885 IEA:Ensembl P endothelial cell development
GO:0045444 IEA:Ensembl P fat cell differentiation
GO:0006749 IEA:Ensembl P glutathione metabolic process
GO:0060047 IEA:Ensembl P heart contraction
GO:0042744 IEA:Ensembl P hydrogen peroxide catabolic process
GO:0051702 IEA:Ensembl P interaction with symbiont
GO:0008631 IEA:Ensembl P intrinsic apoptotic signaling pathway in response to oxidative stress
GO:0051450 IEA:Ensembl P myoblast proliferation
GO:0043066 IEA:Ensembl P negative regulation of apoptotic process
GO:0043154 IEA:Ensembl P negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:1902042 IEA:Ensembl P negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0002862 IEA:Ensembl P negative regulation of inflammatory response to antigenic stimulus
GO:1902176 IEA:Ensembl P negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:0090201 IEA:Ensembl P negative regulation of release of cytochrome c from mitochondria
GO:0051897 IEA:Ensembl P positive regulation of protein kinase B signaling
GO:0018158 IEA:Ensembl P protein oxidation
GO:0040029 IEA:Ensembl P regulation of gene expression, epigenetic
GO:0033599 IEA:Ensembl P regulation of mammary gland epithelial cell proliferation
GO:0043523 IEA:Ensembl P regulation of neuron apoptotic process
GO:0061136 IEA:Ensembl P regulation of proteasomal protein catabolic process
GO:0010332 IEA:Ensembl P response to gamma radiation
GO:0033194 IEA:Ensembl P response to hydroperoxide
GO:0010269 IEA:Ensembl P response to selenium ion
GO:0009609 IEA:Ensembl P response to symbiotic bacterium
GO:0009636 IEA:Ensembl P response to toxic substance
GO:0009410 IEA:Ensembl P response to xenobiotic stimulus
GO:0007605 IEA:Ensembl P sensory perception of sound
GO:0048741 IEA:Ensembl P skeletal muscle fiber development
GO:0043403 IEA:Ensembl P skeletal muscle tissue regeneration
GO:0001659 IEA:Ensembl P temperature homeostasis
GO:0006641 IEA:Ensembl P triglyceride metabolic process
GO:0042311 IEA:Ensembl P vasodilation

KEGG Pathway Links

KEGG Pathway ID Description
ko05014 Amyotrophic lateral sclerosis (ALS)
rno05014 Amyotrophic lateral sclerosis (ALS)
ko00590 Arachidonic acid metabolism
rno00590 Arachidonic acid metabolism
ko00480 Glutathione metabolism
rno00480 Glutathione metabolism
ko05016 Huntington's disease
rno05016 Huntington's disease
ko04918 Thyroid hormone synthesis
rno04918 Thyroid hormone synthesis

REACTOME Pathway Links

REACTOME Pathway ID Description
5953493 Arachidonic acid metabolism
5953238 Cellular responses to stress
5953323 Detoxification of Reactive Oxygen Species
5953250 Metabolism
5953289 Metabolism of lipids and lipoproteins
5953322 Metabolism of nucleotides
5953320 Purine catabolism
5953321 Purine metabolism
5954556 Synthesis of 12-eicosatetraenoic acid derivatives
5954095 Synthesis of 5-eicosatetraenoic acids

Domain Information

InterPro Annotations

Accession Description
IPR000889 Glutathione peroxidase
IPR029760 Glutathione peroxidase conserved site
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
glutathione peroxidase 1
Protein Entry
Q6PDW8_RAT
UniProt ID
Q6PDW8
Species
Rat

Identical and Related Proteins

Unique RefSeq proteins for LMP012405 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
145275165 RefSeq NP_110453 201 glutathione peroxidase 1

Identical Sequences to LMP012405 proteins

Reference Database Accession Length Protein Name
GI:145275165 EMBL CAA30928.2 201 glutathione peroxidase [Rattus norvegicus]
GI:145275165 GenBank AAK72702.1 201 selenium-dependent glutathione peroxidase [Rattus norvegicus]
GI:145275165 GenBank AAA12407.2 201 glutathione peroxidase [Rattus norvegicus]
GI:145275165 SwissProt P04041.4 201 RecName: Full=Glutathione peroxidase 1; Short=GPx-1; Short=GSHPx-1; AltName: Full=Cellular glutathione peroxidase [Rattus norvegicus]

Related Sequences to LMP012405 proteins

Reference Database Accession Length Protein Name
GI:145275165 EMBL CAA30928.2 201 glutathione peroxidase [Rattus norvegicus]
GI:145275165 GenBank AAK72702.1 201 selenium-dependent glutathione peroxidase [Rattus norvegicus]
GI:145275165 SwissProt P04041.4 201 RecName: Full=Glutathione peroxidase 1; Short=GPx-1; Short=GSHPx-1; AltName: Full=Cellular glutathione peroxidase [Rattus norvegicus]