Gene/Proteome Database (LMPD)

LMPD ID
LMP012396
Gene ID
24294
Species
Rattus norvegicus (Rat)
Gene Name
cytochrome P450, family 11, subfamily b, polypeptide 2
Gene Symbol
Cyp11b2
Synonyms
Cp45as; Cyp11b3; RNCP45AS;
Alternate Names
cytochrome P450 11B2, mitochondrial; CYPXIB2; CYPXIB3; P450-Aldo-1; P450-Aldo-2; aldosterone synthase; cytochrome P450-Aldo-1; cytochrome P450-Aldo-2; steroid 11-beta-hydroxylase; cytochrome P450 11B3, mitochondrial; cytochrome P450, subfamily 11B, polypeptide 2; Cytochrome P450 subfamily XIB polypeptide 2 (aldosterone synthase); Cytochrome P450, subfamily XIB, polypeptide 2 (aldosterone synthase);
Chromosome
7
Map Location
7q34
Summary
steroid 11-beta-monooxygenase that catalyzes steps in the biosynthesis of aldosterone, corticosterone, and 18-hydroxycorticosterone [RGD, Feb 2006]
Orthologs
View orthologs and multiple alignments for Cyp11b2

Proteins

cytochrome P450 11B2, mitochondrial
Refseq ID NP_036670
Protein GI 226823212
mRNA ID NM_012538
Length 502
MAMALRVTADVWLARPWQCLHRTRALGTTATLAPKTLKPFEAIPQYSRNKWLKMIQILREQGQENLHLEMHQAFQELGPIFRHSAGGAQIVSVMLPEDAEKLHQVESILPRRMHLEPWVAHRELRGLRRGVFLLNGADWRFNRLKLNPNVLSPKAVQNFVPMVDEVARDFLEALKKKVRQNARGSLTMDVQQSLFNYTIEASNFALFGERLGLLGHDLNPGSLKFIHALHSMFKSTTQLLFLPRSLTRWTSTRVWKEHFDAWDVISEYANRCIWKVHQELRLGSSQTYSGIVAALITQGALPLDAIKANSMELTAGSVDTTAIPLVMTLFELARNPDVQQALRQETLAAEASIAANPQKAMSDLPLLRAALKETLRLYPVGGFLERILNSDLVLQNYHVPAGTLVLLYLYSMGRNPAVFPRPERYMPQRWLERKRSFQHLAFGFGVRQCLGRRLAEVEMLLLLHHMLKTFQVETLRQEDVQMAYRFVLMPSSSPVLTFRPVS

Gene Information

Entrez Gene ID
24294
Gene Name
cytochrome P450, family 11, subfamily b, polypeptide 2
Gene Symbol
Cyp11b2
Species
Rattus norvegicus

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0030425 IDA:RGD C dendrite
GO:0016020 IEA:UniProtKB-KW C membrane
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0047783 IDA:RGD F corticosterone 18-monooxygenase activity
GO:0020037 ISS:UniProtKB F heme binding
GO:0005506 IEA:InterPro F iron ion binding
GO:0004507 IDA:RGD F steroid 11-beta-monooxygenase activity
GO:0006700 IDA:RGD P C21-steroid hormone biosynthetic process
GO:0032342 IDA:RGD P aldosterone biosynthetic process
GO:0071260 IEP:RGD P cellular response to mechanical stimulus
GO:0031670 IEP:RGD P cellular response to nutrient
GO:0071375 IEP:RGD P cellular response to peptide hormone stimulus
GO:0051365 IEP:RGD P cellular response to potassium ion starvation
GO:0006704 IDA:RGD P glucocorticoid biosynthetic process
GO:0045777 IMP:RGD P positive regulation of blood pressure
GO:0042493 IEP:RGD P response to drug
GO:0032868 IEP:RGD P response to insulin
GO:0007584 IEP:RGD P response to nutrient
GO:0043434 IEP:RGD P response to peptide hormone
GO:0009651 IEP:RGD P response to salt stress

KEGG Pathway Links

KEGG Pathway ID Description
M00108 C21-Steroid hormone biosynthesis, progesterone => corticosterone/aldosterone
M00109 C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
rno01100 Metabolic pathways
ko00140 Steroid hormone biosynthesis
rno00140 Steroid hormone biosynthesis

Domain Information

InterPro Annotations

Accession Description
IPR001128 Cytochrome P450
IPR017972 Cytochrome P450, conserved site
IPR002399 Cytochrome P450, mitochondrial

UniProt Annotations

Entry Information

Gene Name
cytochrome P450, family 11, subfamily b, polypeptide 2
Species
Rat

Comments

Comment Type Description
Catalytic Activity A steroid + 2 reduced adrenodoxin + O(2) + 2 H(+) = an 11-beta- hydroxysteroid + 2 oxidized adrenodoxin + H(2)O. {ECO:0000250|UniProtKB:P19099}.
Catalytic Activity Corticosterone + 2 reduced adrenodoxin + O(2) + 2 H(+) = 18-hydroxycorticosterone + 2 oxidized adrenodoxin + H(2)O. {ECO:0000250|UniProtKB:P19099}.
Cofactor Name=heme; Xref=ChEBI:CHEBI:30413; Evidence={ECO:0000250|UniProtKB:P19099};
Function Converts 11-deoxycorticosterone into corticosterone, 18- hydroxycorticosterone, and aldosterone. Also can catalyze the conversion of 11-deoxycortisol to cortisol, 18-hydroxycortisol and cortisone.
Induction A 12-fold increase was seen in the presence of a low sodium-high potassium diet. {ECO:0000269|PubMed:8468320}.
Similarity Belongs to the cytochrome P450 family. {ECO:0000305}.
Subcellular Location Mitochondrion membrane.
Tissue Specificity Adrenal cortex.

Identical and Related Proteins

Unique RefSeq proteins for LMP012396 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
226823212 RefSeq NP_036670 502 cytochrome P450 11B2, mitochondrial

Identical Sequences to LMP012396 proteins

Reference Database Accession Length Protein Name
GI:226823212 GenBank EDM16079.1 502 rCG59633 [Rattus norvegicus]

Related Sequences to LMP012396 proteins

Reference Database Accession Length Protein Name
GI:226823212 DBBJ BAA03172.1 500 aldosterone synthase [Rattus norvegicus]
GI:226823212 GenBank AAB60457.1 506 cytochrome P-450 11-beta hydroxlase/aldosterone synthase [Rattus norvegicus]
GI:226823212 GenBank EDM16079.1 502 rCG59633 [Rattus norvegicus]