Gene/Proteome Database (LMPD)
LMPD ID
LMP012387
Gene ID
Species
Rattus norvegicus (Rat)
Gene Name
acid phosphatase 1, soluble
Gene Symbol
Alternate Names
low molecular weight phosphotyrosine protein phosphatase; LMW-PTPase; low molecular weight cytosolic acid phosphatase; LMW-PTP-I low molecular weight phosphotyrosine protein phosphatase isozyme 1;
Chromosome
6
Map Location
6q16
EC Number
3.1.3.48
Summary
catalyzes the hydrolysis of p-nitrophenyl phosphate; may play a role in synaptic transmission [RGD, Feb 2006]
Orthologs
Proteins
| low molecular weight phosphotyrosine protein phosphatase isoform A | |
|---|---|
| Refseq ID | NP_067085 |
| Protein GI | 10863989 |
| UniProt ID | P41498 |
| mRNA ID | NM_021262 |
| Length | 158 |
| MAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDENVSDNWRIDSAATSTYEVGNPPDYRGQNCMKKHGIHMQHIARQITREDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTH | |
| low molecular weight phosphotyrosine protein phosphatase isoform B | |
|---|---|
| Refseq ID | NP_001129034 |
| Protein GI | 207113137 |
| UniProt ID | B0BNC1 |
| mRNA ID | NM_001135562 |
| Length | 158 |
| MAEVGSKSVLFVCLGNICRSPIAEAVFRKLVTDENVSDNWAIDSSAVSDWNVGRPPDPRAVSCLRNHGISTAHKARQITREDFATFDYILCMDESNLRDLNRKSNQVKNCKAKIELLGSYDPQKQLIIEDPYYGNDSDFEVVYQQCLRCCKAFLEKTH | |
Gene Information
Entrez Gene ID
Gene Name
acid phosphatase 1, soluble
Gene Symbol
Species
Rattus norvegicus
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005737 | IEA:UniProtKB-KW | C | cytoplasm |
| GO:0043005 | IDA:RGD | C | neuron projection |
| GO:0017124 | IDA:RGD | F | SH3 domain binding |
| GO:0003993 | IDA:RGD | F | acid phosphatase activity |
| GO:0004726 | IEA:InterPro | F | non-membrane spanning protein tyrosine phosphatase activity |
| GO:0004725 | IDA:RGD | F | protein tyrosine phosphatase activity |
| GO:0035335 | IDA:GOC | P | peptidyl-tyrosine dephosphorylation |
| GO:0007268 | IEP:RGD | P | synaptic transmission |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Alternative Products | Event=Alternative splicing; Named isoforms=2; Comment=Additional isoforms seem to exist.; Name=1; Synonyms=ACP1, A; IsoId=P41498-1; Sequence=Displayed; Name=2; Synonyms=ACP2, B; IsoId=P41498-2; Sequence=VSP_004705; |
| Catalytic Activity | A phosphate monoester + H(2)O = an alcohol + phosphate. |
| Catalytic Activity | Protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate. |
| Function | Acts on tyrosine phosphorylated proteins, low-MW aryl phosphates and natural and synthetic acyl phosphates. |
| Similarity | Belongs to the low molecular weight phosphotyrosine protein phosphatase family |
| Subcellular Location | Cytoplasm. |
| Subunit | Interacts with EPHA2; dephosphorylates EPHA2. Interacts with EPHB1 (By similarity). Isoform 1 interacts with the SH3 domain of SPTAN1 |
Identical and Related Proteins
Unique RefSeq proteins for LMP012387 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 10863989 | RefSeq | NP_067085 | 158 | low molecular weight phosphotyrosine protein phosphatase isoform A |
| 207113137 | RefSeq | NP_001129034 | 158 | low molecular weight phosphotyrosine protein phosphatase isoform B |
Identical Sequences to LMP012387 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:10863989 | GenBank | AAD50990.1 | 158 | low molecular weight protein tyrosine phosphatase isoform A [Rattus norvegicus] |
| GI:10863989 | GenBank | AAH62229.1 | 158 | Acid phosphatase 1, soluble [Rattus norvegicus] |
| GI:207113137 | GenBank | EDM03241.1 | 158 | rCG61973, isoform CRA_b [Rattus norvegicus] |
| GI:10863989 | GenBank | EDM03242.1 | 158 | rCG61973, isoform CRA_c [Rattus norvegicus] |
| GI:207113137 | GenBank | AAI58764.1 | 158 | Acp1 protein [Rattus norvegicus] |
| GI:207113137 | GenBank | AAI61990.1 | 158 | Acp1 protein [Rattus norvegicus] |
| GI:10863989 | SwissProt | P41498.3 | 158 | RecName: Full=Low molecular weight phosphotyrosine protein phosphatase; Short=LMW-PTP; Short=LMW-PTPase; AltName: Full=Low molecular weight cytosolic acid phosphatase [Rattus norvegicus] |
Related Sequences to LMP012387 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:10863989 | GenBank | AAD50990.1 | 158 | low molecular weight protein tyrosine phosphatase isoform A [Rattus norvegicus] |
| GI:207113137 | GenBank | EDM03241.1 | 158 | rCG61973, isoform CRA_b [Rattus norvegicus] |
| GI:10863989 | GenBank | EDM03242.1 | 158 | rCG61973, isoform CRA_c [Rattus norvegicus] |
| GI:207113137 | GenBank | AAI58764.1 | 158 | Acp1 protein [Rattus norvegicus] |
| GI:207113137 | GenBank | AAI61990.1 | 158 | Acp1 protein [Rattus norvegicus] |
| GI:10863989 | SwissProt | P41498.3 | 158 | RecName: Full=Low molecular weight phosphotyrosine protein phosphatase; Short=LMW-PTP; Short=LMW-PTPase; AltName: Full=Low molecular weight cytosolic acid phosphatase [Rattus norvegicus] |