Gene/Proteome Database (LMPD)

LMPD ID
LMP012373
Gene ID
Species
Homo sapiens (Human)
Gene Name
lipoyl(octanoyl) transferase 2 (putative)
Gene Symbol
Synonyms
Chromosome
11
Map Location
11q13.4
EC Number
2.3.1.181

Proteins

putative lipoyltransferase 2, mitochondrial precursor
Refseq ID NP_001138341
Protein GI 221554520
UniProt ID A6NK58
mRNA ID NM_001144869
Length 231
MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQAEPGIEAPSGTEAGALLLCEPAGPVYTAGLRGGLTPEETARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVASLEACAVRLCELQGLQDARARPPPYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCTLISEDSPN
transit_peptide: 1..31 inference: non-experimental evidence, no additional details recorded note: Mitochondrion (Potential); propagated from UniProtKB/Swiss-Prot (A6NK58.1) calculated_mol_wt: 3761 peptide sequence: MRQPAVRLVRLGRVPYAELLGLQDRWLRRLQ mat_peptide: 32..231 product: Putative lipoyltransferase 2, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (A6NK58.1) calculated_mol_wt: 21453 peptide sequence: AEPGIEAPSGTEAGALLLCEPAGPVYTAGLRGGLTPEETARLRALGAEVRVTGRGGLATFHGPGQLLCHPVLDLRRLGLRLRMHVASLEACAVRLCELQGLQDARARPPPYTGVWLDDRKICAIGVRCGRHITSHGLALNCSTDLTWFEHIVPCGLVGTGVTSLSKELQRHVTVEEVMPPFLVAFKEIYKCTLISEDSPN

Gene Information

Entrez Gene ID
Gene Name
lipoyl(octanoyl) transferase 2 (putative)
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005739 IEA:UniProtKB-KW C mitochondrion
GO:0016874 IEA:UniProtKB-KW F ligase activity
GO:0033819 IEA:UniProtKB-EC F lipoyl(octanoyl) transferase activity
GO:0016415 IEA:InterPro F octanoyltransferase activity
GO:0006464 IEA:InterPro P cellular protein modification process
GO:0009107 IEA:InterPro P lipoate biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
hsa00785 Lipoic acid metabolism
ko00785 Lipoic acid metabolism
hsa01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR004143 Biotin/lipoate A/B protein ligase
IPR000544 Octanoyltransferase

UniProt Annotations

Entry Information

Gene Name
lipoyl(octanoyl) transferase 2 (putative)
UniProt ID
Species
Human

Comments

Comment Type Description
Catalytic Activity Octanoyl-[acyl-carrier-protein] + protein = protein N(6)-(octanoyl)lysine + [acyl-carrier-protein].
Function Catalyzes the transfer of endogenously produced octanoic acid from octanoyl-acyl-carrier-protein onto the lipoyl domains of lipoate-dependent enzymes. Lipoyl-ACP can also act as a substrate although octanoyl-ACP is likely to be the physiological substrate (By similarity)
Miscellaneous In the reaction, the free carboxyl group of octanoic acid is attached via an amide linkage to the epsilon- amino group of a specific lysine residue of lipoyl domains of lipoate-dependent enzymes
Pathway Protein modification; protein lipoylation via endogenous pathway; protein N(6)-(lipoyl)lysine from octanoyl-[acyl-carrier- protein]: step 1/2.
Similarity Belongs to the LipB family
Similarity Contains 1 BPL/LPL catalytic domain
Subcellular Location Mitochondrion

Identical and Related Proteins

Unique RefSeq proteins for LMP012373 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
221554520 RefSeq NP_001138341 231 putative lipoyltransferase 2, mitochondrial precursor

Identical Sequences to LMP012373 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP012373 proteins

Reference Database Accession Length Protein Name