Gene/Proteome Database (LMPD)

LMPD ID
LMP012357
Gene ID
Species
Homo sapiens (Human)
Gene Name
coenzyme Q4
Gene Symbol
Synonyms
CGI-92;
Chromosome
9
Map Location
9q34.11
Summary
Coenzyme Q (CoQ) is a small lipophilic molecule that transports electrons between mitochondrial respiratory chain complexes and functions as a cofactor for mitochondrial enzymes. COQ4 is an enzyme involved in CoQ biosynthesis (Casarin et al., 2008 [PubMed 18474229]).[supplied by OMIM, Aug 2009]
Orthologs

Proteins

ubiquinone biosynthesis protein COQ4 homolog, mitochondrial precursor
Refseq ID NP_057119
Protein GI 166795285
UniProt ID Q9Y3A0
mRNA ID NM_016035
Length 265
MATLLRPVLRRLCGLPGLQRPAAEMPLRARSDGAGPLYSHHLPTSPLQKALLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA
transit_peptide: 1..30 experiment: experimental evidence, no additional details recorded note: Mitochondrion. {ECO:0000255|HAMAP-Rule:MF_03111}; propagated from UniProtKB/Swiss-Prot (Q9Y3A0.3) calculated_mol_wt: 3357 peptide sequence: MATLLRPVLRRLCGLPGLQRPAAEMPLRAR mat_peptide: 31..265 product: Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial experiment: experimental evidence, no additional details recorded note: propagated from UniProtKB/Swiss-Prot (Q9Y3A0.3) calculated_mol_wt: 26333 peptide sequence: SDGAGPLYSHHLPTSPLQKALLAAGSAAMALYNPYRHDMVAVLGETTGHRTLKVLRDQMRRDPEGAQILQERPRISTSTLDLGKLQSLPEGSLGREYLRFLDVNRVSPDTRAPTRFVDDEELAYVIQRYREVHDMLHTLLGMPTNILGEIVVKWFEAVQTGLPMCILGAFFGPIRLGAQSLQVLVSELIPWAVQNGRRAPCVLNLYYERRWEQSLRALREELGITAPPMHVQGLA

Gene Information

Entrez Gene ID
Gene Name
coenzyme Q4
Gene Symbol
Species
Homo sapiens

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0005743 IEA:UniProtKB-KW C mitochondrial inner membrane
GO:0005739 IDA:LIFEdb C mitochondrion
GO:0006744 IEA:UniProtKB-UniPathway P ubiquinone biosynthetic process

Domain Information

InterPro Annotations

Accession Description
IPR007715 Ubiquinone biosynthesis protein Coq4
IPR027540 Ubiquinone biosynthesis protein Coq4, eukaryotes

UniProt Annotations

Entry Information

Gene Name
coenzyme Q4
UniProt ID
Species
Human

Comments

Comment Type Description
Alternative Products Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=Q9Y3A0-1; Sequence=Displayed; Name=2; IsoId=Q9Y3A0-2; Sequence=VSP_036866;
Function Component of the coenzyme Q biosynthetic pathway. May play a role in organizing a multi-subunit COQ enzyme complex required for coenzyme Q biosynthesis. Required for steady-state levels of other COQ polypeptides. {ECO:0000255|HAMAP- Rule:MF_03111, ECO:0000269|PubMed:18474229}.
Pathway Cofactor biosynthesis; ubiquinone biosynthesis
Similarity Belongs to the COQ4 family. {ECO:0000255|HAMAP- Rule:MF_03111}.
Subcellular Location Isoform 1: Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.
Subunit Component of a multi-subunit COQ enzyme complex, composed of at least COQ3, COQ4, COQ5, COQ6, COQ7 and COQ9
Tissue Specificity Expressed ubiquitously, but at high levels in liver, lung and pancreas

Identical and Related Proteins

Unique RefSeq proteins for LMP012357 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
166795285 RefSeq NP_057119 265 ubiquinone biosynthesis protein COQ4 homolog, mitochondrial precursor

Identical Sequences to LMP012357 proteins

Reference Database Accession Length Protein Name

Related Sequences to LMP012357 proteins

Reference Database Accession Length Protein Name