Gene/Proteome Database (LMPD)
LMPD ID
LMP012327
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
zgc:158420
Gene Symbol
Chromosome
7
Proteins
| palmitoyltransferase ZDHHC21 | |
|---|---|
| Refseq ID | NP_001116527 |
| Protein GI | 176866347 |
| UniProt ID | B1H1H3 |
| mRNA ID | NM_001123055 |
| Length | 263 |
| RefSeq Status | PROVISIONAL |
| MKMRLHFVVDPMGWFCMSMVFFVWIYNSFLIPKLVLLPHYAEGHITAEPVICYYLASLLCFSALFRASTTDPGKLAQDPKIPLAERDNWELCNKCNMMRPKRSHHCSRCGHCVRRMDHHCPWINNCVGEDNHWLFLQLCFYTQVLSFYTLVLDFCQYYYFLPLSSVDQADFAVHHELALLRVSCFMGLIMFGGISSLFYTQVKGILTDTTTIEKMSHLTEEVPRRPWQQAMAEVFGTRWKVLWFLPFRSRHPLRLNLTIRSHV | |
Gene Information
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0019706 | IEA:UniProtKB-EC | F | protein-cysteine S-palmitoyltransferase activity |
| GO:0008270 | IEA:InterPro | F | zinc ion binding |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR001594 | Zinc finger, DHHC-type, palmitoyltransferase |
UniProt Annotations
Entry Information
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA. |
| Domain | The DHHC domain is required for palmitoyltransferase activity. |
| Similarity | Belongs to the DHHC palmitoyltransferase family. |
| Similarity | Contains 1 DHHC-type zinc finger. |
| Similarity | Contains DHHC-type zinc finger. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012327 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 176866347 | RefSeq | NP_001116527 | 263 | palmitoyltransferase ZDHHC21 |
Identical Sequences to LMP012327 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:176866347 | GenBank | AAI60605.1 | 263 | Zgc:158420 protein [Danio rerio] |
Related Sequences to LMP012327 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:176866347 | GenBank | AHH39131.1 | 264 | putative palmitoyltransferase ZDHHC21 [Ictalurus punctatus] |
| GI:176866347 | GenBank | AHH41966.1 | 264 | putative palmitoyltransferase ZDHHC21 [Ictalurus punctatus] |
| GI:176866347 | RefSeq | XP_003452460.1 | 265 | PREDICTED: probable palmitoyltransferase ZDHHC21-like isoform X1 [Oreochromis niloticus] |
| GI:176866347 | RefSeq | XP_005748098.1 | 265 | PREDICTED: probable palmitoyltransferase ZDHHC21-like [Pundamilia nyererei] |
| GI:176866347 | RefSeq | XP_007255801.1 | 264 | PREDICTED: palmitoyltransferase ZDHHC21 [Astyanax mexicanus] |
| GI:176866347 | RefSeq | XP_008294570.1 | 265 | PREDICTED: palmitoyltransferase ZDHHC21 [Stegastes partitus] |