Gene/Proteome Database (LMPD)
Proteins
| post-GPI attachment to proteins factor 3 precursor | |
|---|---|
| Refseq ID | NP_001108063 |
| Protein GI | 167621550 |
| UniProt ID | A8WFS8 |
| mRNA ID | NM_001114591 |
| Length | 316 |
| RefSeq Status | PROVISIONAL |
| MFLAAAAFLLSAPASASQGDKEPVYRDCVKHCVRANCTGARLRGFQSTQPPYMALTGWTCRDDCRYQCMWTTVGLYQAEGYSIPQFHGKWPFARFLCFEEPASALASLLNGLACLLMLLRYRSAVPCQSPMYHTITAFSLVSLNAWFWSTVFHTRDTYLTEKMDYFCASAVILYSIYLCCVRTLGLRRPAISSMVGVLLILAFTSHVSYLTFVSFDYGYNMAANASIGIINLLWWLCWCWLNRRILPYWWRCGMVVLLLHGLALLELLDFPPLFWVLDAHAVWHLSTVPVHFLFYSFLIDDSLHLLNTEKPGVKLD | |
Gene Information
Entrez Gene ID
Gene Name
post-GPI attachment to proteins 3
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0005794 | IEA:UniProtKB-KW | C | Golgi apparatus |
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0031227 | ISS:UniProtKB | C | intrinsic component of endoplasmic reticulum membrane |
| GO:0016788 | ISS:UniProtKB | F | hydrolase activity, acting on ester bonds |
| GO:0006506 | IEA:UniProtKB-KW | P | GPI anchor biosynthetic process |
| GO:0006505 | ISS:UniProtKB | P | GPI anchor metabolic process |
Domain Information
InterPro Annotations
| Accession | Description |
|---|---|
| IPR007217 | Per1-like |
UniProt Annotations
Entry Information
Gene Name
post-GPI attachment to proteins 3
Protein Entry
PGAP3_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Function | Involved in the lipid remodeling steps of GPI-anchor maturation. {ECO:0000250}. |
| Similarity | Belongs to the PGAP3 family. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus membrane {ECO:0000250}; Multi-pass membrane protein {ECO:0000250}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012325 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 167621550 | RefSeq | NP_001108063 | 316 | post-GPI attachment to proteins factor 3 precursor |
Identical Sequences to LMP012325 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:167621550 | GenBank | AAI54444.1 | 316 | Zgc:171485 protein [Danio rerio] |
| GI:167621550 | SwissProt | A8WFS8.1 | 316 | RecName: Full=Post-GPI attachment to proteins factor 3; AltName: Full=PER1-like domain-containing protein 1; Flags: Precursor [Danio rerio] |
Related Sequences to LMP012325 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:167621550 | EMBL | CDQ75401.1 | 336 | unnamed protein product [Oncorhynchus mykiss] |
| GI:167621550 | RefSeq | XP_003961434.1 | 349 | PREDICTED: post-GPI attachment to proteins factor 3-like [Takifugu rubripes] |
| GI:167621550 | RefSeq | XP_004575037.1 | 357 | PREDICTED: post-GPI attachment to proteins factor 3-like [Maylandia zebra] |
| GI:167621550 | RefSeq | XP_007239376.1 | 323 | PREDICTED: post-GPI attachment to proteins factor 3-like [Astyanax mexicanus] |
| GI:167621550 | RefSeq | XP_008281815.1 | 356 | PREDICTED: post-GPI attachment to proteins factor 3 [Stegastes partitus] |
| GI:167621550 | RefSeq | XP_008302298.1 | 356 | PREDICTED: post-GPI attachment to proteins factor 3 [Stegastes partitus] |