Gene/Proteome Database (LMPD)

LMPD ID
LMP012281
Gene ID
Species
Danio rerio (Zebrafish)
Gene Name
prostaglandin E synthase 2-like
Gene Symbol
Synonyms
ptges2; zgc:56527
Alternate Names
prostaglandin E synthase 2; mPGES-2; microsomal prostaglandin E synthase 2
Chromosome
8
EC Number
5.3.99.3

Proteins

prostaglandin E synthase 2
Refseq ID NP_956574
Protein GI 41053638
UniProt ID Q7ZUC7
mRNA ID NM_200280
Length 377
RefSeq Status PROVISIONAL
MAAACTRTLGKVGRLVLDTPTCRFTNTAAFVPRTSMRCQGRAYGTGSSGFKSRLLLAAPVRGSGRVLGCAFLLGGGFGLYQTIKLTLQHHLAEKESDASDLDTDLKLTLYQYKTCPFCSKVRAFLDYHRLPYEIVEVNPVMRQEIKWSTYRKVPILMVNGTVQLNDSSVIISALKTYISSKDKKISEILACYPEMKSKNDRGKDVIEFGNKYWVMVHDADADQLYPGKDSRKEEIKWRTWADDWLVHLISPNVYRTPTEALASFDYIVREGKFGSFEGFFAKYFGAAAMWIISKRLKYKHNLQADVRQDLYKAVNDWVAAIGKNKQFMGGDEPNLADLAVFGVLRVMEGLQSFDDMMEHTKVKKWYSRMQKATQHVS

Gene Information

Entrez Gene ID
Gene Name
prostaglandin E synthase 2-like
Gene Symbol
Species
Danio rerio

Gene Ontology (GO Annotations)

GO ID Source Type Description
GO:0016021 IEA:UniProtKB-KW C integral component of membrane
GO:0009055 IEA:InterPro F electron carrier activity
GO:0043295 ISS:UniProtKB F glutathione binding
GO:0020037 ISS:UniProtKB F heme binding
GO:0016829 ISS:UniProtKB F lyase activity
GO:0050220 IEA:UniProtKB-EC F prostaglandin-E synthase activity
GO:0015035 IEA:InterPro F protein disulfide oxidoreductase activity
GO:0045454 IEA:InterPro P cell redox homeostasis
GO:0001516 IEA:UniProtKB-UniPathway P prostaglandin biosynthetic process

KEGG Pathway Links

KEGG Pathway ID Description
dre00590 Arachidonic acid metabolism
ko00590 Arachidonic acid metabolism
dre01100 Metabolic pathways

Domain Information

InterPro Annotations

Accession Description
IPR002109 Glutaredoxin
IPR011767 Glutaredoxin active site
IPR004046 Glutathione S-transferase, C-terminal
IPR010987 Glutathione S-transferase, C-terminal-like
IPR012336 Thioredoxin-like fold

UniProt Annotations

Entry Information

Gene Name
prostaglandin E synthase 2-like
Protein Entry
PGES2_DANRE
UniProt ID
Species
Zebrafish

Comments

Comment Type Description
Catalytic Activity (5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15- dihydroxy-9-oxoprosta-5,13-dienoate. {ECO:0000250|UniProtKB:Q66LN0}.
Enzyme Regulation Isomerase activity is increased by sulfhydril compounds. Dithiothreitol (DTT) is most effective, followed by glutathione (GSH) and 2-mercaptoethanol. {ECO:0000250|UniProtKB:Q66LN0}.
Function Isomerase that catalyzes the conversion of PGH2 into the more stable prostaglandin E2 (PGE2). {ECO:0000250|UniProtKB:Q66LN0}.
Pathway Lipid metabolism; prostaglandin biosynthesis. {ECO:0000250|UniProtKB:Q66LN0}.
Similarity Belongs to the GST superfamily. {ECO:0000305}.
Similarity Contains 1 GST C-terminal domain. {ECO:0000305}.
Similarity Contains 1 GST N-terminal domain. {ECO:0000305}.
Subcellular Location Golgi apparatus membrane {ECO:0000250|UniProtKB:Q9H7Z7}; Single-pass membrane protein {ECO:0000250|UniProtKB:Q9H7Z7}.
Subunit Homodimer. {ECO:0000250|UniProtKB:Q66LN0}.

Identical and Related Proteins

Unique RefSeq proteins for LMP012281 (as displayed in Record Overview)

Protein GI Database Accession Length Protein Name
41053638 RefSeq NP_956574 377 prostaglandin E synthase 2

Identical Sequences to LMP012281 proteins

Reference Database Accession Length Protein Name
GI:41053638 GenBank AAH49325.1 377 Prostaglandin E synthase 2-like [Danio rerio]
GI:41053638 SwissProt Q7ZUC7.1 377 RecName: Full=Prostaglandin E synthase 2; AltName: Full=Microsomal prostaglandin E synthase 2; Short=mPGES-2 [Danio rerio]

Related Sequences to LMP012281 proteins

Reference Database Accession Length Protein Name
GI:41053638 GenBank AAI71675.1 377 Prostaglandin E synthase 2-like [Danio rerio]
GI:41053638 RefSeq XP_003444575.1 386 PREDICTED: prostaglandin E synthase 2-like isoform X1 [Oreochromis niloticus]
GI:41053638 RefSeq XP_004555760.1 387 PREDICTED: prostaglandin E synthase 2-like isoform X1 [Maylandia zebra]
GI:41053638 RefSeq XP_005451550.1 387 PREDICTED: prostaglandin E synthase 2-like isoform X2 [Oreochromis niloticus]
GI:41053638 RefSeq XP_005451551.1 384 PREDICTED: prostaglandin E synthase 2-like isoform X3 [Oreochromis niloticus]
GI:41053638 RefSeq XP_005949006.1 438 PREDICTED: prostaglandin E synthase 2-like isoform X2 [Haplochromis burtoni]