Gene/Proteome Database (LMPD)
Proteins
| prostaglandin E synthase 2 | |
|---|---|
| Refseq ID | NP_956574 |
| Protein GI | 41053638 |
| UniProt ID | Q7ZUC7 |
| mRNA ID | NM_200280 |
| Length | 377 |
| RefSeq Status | PROVISIONAL |
| MAAACTRTLGKVGRLVLDTPTCRFTNTAAFVPRTSMRCQGRAYGTGSSGFKSRLLLAAPVRGSGRVLGCAFLLGGGFGLYQTIKLTLQHHLAEKESDASDLDTDLKLTLYQYKTCPFCSKVRAFLDYHRLPYEIVEVNPVMRQEIKWSTYRKVPILMVNGTVQLNDSSVIISALKTYISSKDKKISEILACYPEMKSKNDRGKDVIEFGNKYWVMVHDADADQLYPGKDSRKEEIKWRTWADDWLVHLISPNVYRTPTEALASFDYIVREGKFGSFEGFFAKYFGAAAMWIISKRLKYKHNLQADVRQDLYKAVNDWVAAIGKNKQFMGGDEPNLADLAVFGVLRVMEGLQSFDDMMEHTKVKKWYSRMQKATQHVS | |
Gene Information
Entrez Gene ID
Gene Name
prostaglandin E synthase 2-like
Gene Symbol
Species
Danio rerio
Gene Ontology (GO Annotations)
| GO ID | Source | Type | Description |
|---|---|---|---|
| GO:0016021 | IEA:UniProtKB-KW | C | integral component of membrane |
| GO:0009055 | IEA:InterPro | F | electron carrier activity |
| GO:0043295 | ISS:UniProtKB | F | glutathione binding |
| GO:0020037 | ISS:UniProtKB | F | heme binding |
| GO:0016829 | ISS:UniProtKB | F | lyase activity |
| GO:0050220 | IEA:UniProtKB-EC | F | prostaglandin-E synthase activity |
| GO:0015035 | IEA:InterPro | F | protein disulfide oxidoreductase activity |
| GO:0045454 | IEA:InterPro | P | cell redox homeostasis |
| GO:0001516 | IEA:UniProtKB-UniPathway | P | prostaglandin biosynthetic process |
KEGG Pathway Links
Domain Information
UniProt Annotations
Entry Information
Gene Name
prostaglandin E synthase 2-like
Protein Entry
PGES2_DANRE
UniProt ID
Species
Zebrafish
Comments
| Comment Type | Description |
|---|---|
| Catalytic Activity | (5Z,13E)-(15S)-9-alpha,11-alpha-epidioxy-15- hydroxyprosta-5,13-dienoate = (5Z,13E)-(15S)-11-alpha,15- dihydroxy-9-oxoprosta-5,13-dienoate. {ECO:0000250|UniProtKB:Q66LN0}. |
| Enzyme Regulation | Isomerase activity is increased by sulfhydril compounds. Dithiothreitol (DTT) is most effective, followed by glutathione (GSH) and 2-mercaptoethanol. {ECO:0000250|UniProtKB:Q66LN0}. |
| Function | Isomerase that catalyzes the conversion of PGH2 into the more stable prostaglandin E2 (PGE2). {ECO:0000250|UniProtKB:Q66LN0}. |
| Pathway | Lipid metabolism; prostaglandin biosynthesis. {ECO:0000250|UniProtKB:Q66LN0}. |
| Similarity | Belongs to the GST superfamily. {ECO:0000305}. |
| Similarity | Contains 1 GST C-terminal domain. {ECO:0000305}. |
| Similarity | Contains 1 GST N-terminal domain. {ECO:0000305}. |
| Subcellular Location | Golgi apparatus membrane {ECO:0000250|UniProtKB:Q9H7Z7}; Single-pass membrane protein {ECO:0000250|UniProtKB:Q9H7Z7}. |
| Subunit | Homodimer. {ECO:0000250|UniProtKB:Q66LN0}. |
Identical and Related Proteins
Unique RefSeq proteins for LMP012281 (as displayed in Record Overview)
| Protein GI | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| 41053638 | RefSeq | NP_956574 | 377 | prostaglandin E synthase 2 |
Identical Sequences to LMP012281 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41053638 | GenBank | AAH49325.1 | 377 | Prostaglandin E synthase 2-like [Danio rerio] |
| GI:41053638 | SwissProt | Q7ZUC7.1 | 377 | RecName: Full=Prostaglandin E synthase 2; AltName: Full=Microsomal prostaglandin E synthase 2; Short=mPGES-2 [Danio rerio] |
Related Sequences to LMP012281 proteins
| Reference | Database | Accession | Length | Protein Name |
|---|---|---|---|---|
| GI:41053638 | GenBank | AAI71675.1 | 377 | Prostaglandin E synthase 2-like [Danio rerio] |
| GI:41053638 | RefSeq | XP_003444575.1 | 386 | PREDICTED: prostaglandin E synthase 2-like isoform X1 [Oreochromis niloticus] |
| GI:41053638 | RefSeq | XP_004555760.1 | 387 | PREDICTED: prostaglandin E synthase 2-like isoform X1 [Maylandia zebra] |
| GI:41053638 | RefSeq | XP_005451550.1 | 387 | PREDICTED: prostaglandin E synthase 2-like isoform X2 [Oreochromis niloticus] |
| GI:41053638 | RefSeq | XP_005451551.1 | 384 | PREDICTED: prostaglandin E synthase 2-like isoform X3 [Oreochromis niloticus] |
| GI:41053638 | RefSeq | XP_005949006.1 | 438 | PREDICTED: prostaglandin E synthase 2-like isoform X2 [Haplochromis burtoni] |